SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018710 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018710
Domain Number 1 Region: 200-419
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-60
Family DBL homology domain (DH-domain) 0.0000564
Further Details:      
 
Domain Number 2 Region: 408-551
Classification Level Classification E-value
Superfamily PH domain-like 2.63e-17
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 3 Region: 560-621
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000394
Family SH3-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018710   Gene: ENSXMAG00000018659   Transcript: ENSXMAT00000018738
Sequence length 639
Comment pep:novel scaffold:Xipmac4.4.2:JH556705.1:204223:215424:1 gene:ENSXMAG00000018659 transcript:ENSXMAT00000018738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETQKVVLSTESPAAKKLGTHQLIPKSLAVSSRPKNRHHTTVVTFPVGRENSNSENHSRHS
AQGPEVSWDDYDSDGDGSAFRRNRRNKSYRAAVTSLDIDAMTSETAPKTTLKPVDENRES
SPGPSLSNRRKRSLGRKRNQRGSFKDATPCLYQEIRERGLDSTQQDELLEDFVVVEPPAE
DHGIVMKSYKQAHLTWSQLPQVQESGILSTITPQERKRQEAIFEIITSEHSYLHSLGILV
RHFKNSAALKKTMTTTEHHHLFSNISVILTASQRFFTDLEQRHNEQLVIRDISDIVKNHA
AHHFAPYIVYCSNETFQQRTLQKLLNNNSAFKDTLKEIERNSECGGLPMFSFLILPMQRV
TRLPLLLDTICQKTQDQTAEYFAAVWALKAMSKLVTECNDGARRMERTEQMYTIQKQMEF
GKIKPFPLVSASRWLKKRGELAVSSEELSLWRAFTNRSYYLFLFNDVLIVTKKKSEESFV
VLXYATLDNVQVEFGEDADVRTSPSKSNSNYLSFKLRMSKNSEGKLEQISLVADSRVDRA
RWITALKEQKQEGVFTCTDGLPQYEVTKTHMPKEPDELGLRQAEVVIVLQKEEEWCYGER
MRDGERGWFPANCATEITDPTAMESNVQRMKRLRKETNV
Download sequence
Identical sequences M4AW65
ENSXMAP00000018710 ENSXMAP00000018710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]