SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018941 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018941
Domain Number 1 Region: 85-420
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.47e-87
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000807
Further Details:      
 
Domain Number 2 Region: 958-1013
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000141
Family Ubiquitin-related 0.01
Further Details:      
 
Domain Number 3 Region: 470-548
Classification Level Classification E-value
Superfamily DUSP-like 0.0000000824
Family DUSP, domain in ubiquitin-specific proteases 0.015
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000018941
Domain Number - Region: 742-790
Classification Level Classification E-value
Superfamily DUSP-like 0.0615
Family DUSP, domain in ubiquitin-specific proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018941   Gene: ENSXMAG00000018856   Transcript: ENSXMAT00000018969
Sequence length 1046
Comment pep:novel scaffold:Xipmac4.4.2:JH557446.1:56261:75742:1 gene:ENSXMAG00000018856 transcript:ENSXMAT00000018969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRVKLEKAAWLWVETVKPEDIKHEHIELAYRINIPACKRGICRRNCKGNPNCLVGIGE
QVWLGEIDENTFHNIDDPNSERREKNIFVGLTNLGATCYVNTFLQVWFHNLELRKSLYQC
QNSRAQEHNIDSDYEPQSICEHLQYLFALLQNSNRKYIDPSGLVKALGLDTGQQQDAQEF
SNLFLSLLEETLSKEKNPNLQNLIQQQFCGQFFYVTICNQCGRSSTLPSRFYELELNIQG
HKNLTECITEFLKEEKLDGENRYFCENCQSKQNATRRIRLHSLPPTLNLQLMRFVFDRQT
GLKKKLNTFINFPEQLDMEPFLEQKLDQKCVYELSAVLIHRGISAYSGHYIAHVKDALTG
DWYKFNDEEIEKMEGKKLQLGIEEDIAETGKTQSRKPKCSKGYHCSRNAYMLVYKVQEDE
SSNPSRTNVEVPSFLQKLVDQDNHKFEEWCMEMAHMRKQSVDKGRAKHEEVKELYDLLPA
KDEELYEFLPLEWLKKWLDDSTATKEIDNSIFLCSHGKLHPDNMGEIKRVSLEAAKLLYE
RYGGGPKLDGSSLCRDCVSERCRVLRLKKQLDEDYKEISNLVKRTTSSDGYWVGKPSLRS
WRQLAMEQLEEDEQESKHSNGQTNGQGPHTNNKFGMEATAGAEDEMKTFNEDIVCTHGAL
SILETERKLVSTEVWTKLREYFPRAPEFTHMQEPCRQCLTLEQEEKDNEAVSKMMALEQK
NQLLNLFHEKNRPVLTKWPQGTDKLYIVPLFFVEEWRKFIRRPTKSSPVSNVGNSLLLCP
HGGFMFTYDSLINGEAQHIALLWPSEWEVISRLFIVDKPIAIHCVRQTESSMTQYTTQPD
LCWECRESFLFQQQRDLREYTQATVYVRKVIEDKTMAKDGAPELNACSSEAEEEREELPK
VDGEKDPDFSQAQDTAKRLKLSDSTAAVVAAPAVTNTMKPGSIRRSTRHRKLRGEKALIV
SANQTLKELKIQIMHAFSVAPFDQNLSIDGKSLTDDSATLGSLGVIPECIICLKADEPVT
DYAAMDDAYQVRMPEEGFKGTGLLGH
Download sequence
Identical sequences M4AWU6
ENSXMAP00000018941 ENSXMAP00000018941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]