SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000019016 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000019016
Domain Number 1 Region: 1475-1654
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.16e-40
Family DBL homology domain (DH-domain) 0.0000495
Further Details:      
 
Domain Number 2 Region: 1664-1778
Classification Level Classification E-value
Superfamily PH domain-like 2.25e-33
Family Pleckstrin-homology domain (PH domain) 0.00075
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000019016
Domain Number - Region: 941-1082
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0194
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000019016   Gene: ENSXMAG00000018976   Transcript: ENSXMAT00000019044
Sequence length 1969
Comment pep:novel scaffold:Xipmac4.4.2:JH556705.1:378711:402290:-1 gene:ENSXMAG00000018976 transcript:ENSXMAT00000019044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLDSVEGSIQHLLSALYPPYEATAPTLLSQLFQIIDGRYQRDALRCFLDFLVPAKHILD
TVQQAACAQYSNVLFLCEGWPLCLRDQVVVHLAPIDPSLLQPGDFYLQVTPFCDQSARIV
VCSLLKEEGLAVEVVEETPVPETSYPCIFSSGWLDEINQDRQGSPLRQCLVATERGVVRL
PWERVAVPDFVQLPPPPPLPDSSKTSSSDNAFFPLSSSKKSEQLNPVTASQNSGLTSSPA
AFSVETRICPAKHGIAVSLCLVDARTSSLSHLVKIKGSEAEHKPIGWVSPHTWDSRFTGT
NQNATAKTEKPSLSGGNIIDFKCIRTVRFAEKPCTPCLARRQGGKVSKAQELRCRYRDSY
QAAIQNPVTFGAENNRGNMPAVVEEDTDTSQSADKLRAKDSWRGVQDTRCHPGSCNQSPE
QLGGDICKESGEINCVPCRKPKEINVMPYNDGRVQSVKSSGNFHSTSTTNPTSEMRTQTT
NVLSATDDLRYPDNFNKQHRSKFSSAETSEIHMPFNHLESHQTRPSLMTMAPNFKSTPAP
QNRRDTHPDRRCSSLSTAVVDTSEKCELIIVEGQNVRRKETSEPCAEIPQLHVVKCKNST
AFRLVSPKINRKKNPLPVAEQLGTRRINSHETENSSQMTPSSSTETKRASRQASARPRPD
HLPLGSPDPRAHPVYSGLASLTGYSSTPLNKGDQQRSHYKVNTKCIPTHVNRIILCRIGC
RDRTGRAIVELYGHDQGWESTVTSHELFQMLLYFYSITRKEIREAGMTLIFDARKKSPQP
QFYKALMALHEWSPRAVNSLVLLVDKENNPQPERCPGIQTDLVTSMKALLKLVEVNQLSF
GLDGTAHGYCDWLELHQRLFPFVNNLHEVSSLLLRAISKLEELRMTETVQAVQQCMMDQR
TLMRDVLEDSRLVGLQREGGAILARLRKESDLKYPHCEDLSDAVDSVTSLYNYVEEQAHI
LVQRTNVSLEHLEYLLQLREMEGHFMQIQQWFAVEGERHLMEAESVEGSGERMEQILNSF
TGFLIEASDRRHHAMSLVSEAERLQQSGLPYPETAAFKTLIGTFQSDLEDFLCRAEACGR
ELQIMVNICDFCEQAVELANECTDYLNLTEARNLTVQSPESASWISQTSFQEKFLHFSPE
KLHEVKVHAGSLRGSRGMHVWNAAWLRFHEAQQQLQERMQELEELRHQPADPSSRCEGHF
VDVVSTNIQTASPGGQRLVVQSTPGPQRSQWEGILSGAEDLGKRRPVLDSSSPNPAAVAC
SNITIIPEGSSDAGTNQESKQSSHSLVQAVAFRCQLCLSSHNFSFCKEAVETVKSKISPV
CWMVSFLNRSARRTEREARKRHTSRARSERDAAALSQSHPVGCQWFPWRRGLGARSVSQD
SCAARASAAGSTPEEQGPRSPPCCSHRGQPSCRILQEAQKFQISRHGSFCSDNSCMSDGG
AAGAECCKHSSLPPETYGRAFCLSGPQENASSALRVQHVMEELVFTEREYVRSLGYILTH
YLPLMDRLDIPQDLRGKRGIIFGNLEKVYDFHSHYFLPELEACERQPAMVARCFLRHSES
FGLYALYSKNKPQSDALILHRRHDIFKKKQQELGDLMDLSSYLLRPIQRISKYSLLLQDM
LALDSTCIERDRERSEIQAAAHLIQFQMRHGNDLLTMDAIQDCDVNLKEQGELIRQDEFT
VFFRKKKCVRRVFLFEHLILFSKTKRTDIGNDVYVCKQSFKTNDIGMTHNSGVSGLCFEI
WFRRRKSEDTYTLKASSTEVKEAWTTDLERILWNQAAHSRELRLQERVFMGTGRSPFMDI
QPSDAAICDRAVSCVLPGRNRGLDYPRPHSIGSGSTASTTVSQSSSSSGRGSLPPSGYLG
NTNPGVGSSPEAVTENELNSHHLLQHQPHPHCDQWKTHCPLIDSTDSSGESMNLYSSPDH
SCLSAISGEVVDDSSSVSQRSEQKTLSTKHIHNNLGANITGKLGRSTEV
Download sequence
Identical sequences M4AX21
ENSXMAP00000019016 ENSXMAP00000019016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]