SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000019017 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000019017
Domain Number 1 Region: 546-613
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000023
Family IBR domain 0.023
Further Details:      
 
Domain Number 2 Region: 628-691
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000906
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 37-149
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000676
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.014
Further Details:      
 
Domain Number 4 Region: 388-415
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000392
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 
Domain Number 5 Region: 235-297
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000444
Family Ubiquitin-related 0.018
Further Details:      
 
Domain Number 6 Region: 472-554
Classification Level Classification E-value
Superfamily RING/U-box 0.000000191
Family RING finger domain, C3HC4 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000019017   Gene: ENSXMAG00000018972   Transcript: ENSXMAT00000019045
Sequence length 705
Comment pep:novel scaffold:Xipmac4.4.2:JH556944.1:94381:104031:-1 gene:ENSXMAG00000018972 transcript:ENSXMAT00000019045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSSGGWTHSPGLTPDQSTALTSSYEASQAQPGCQTVLMSVRVSVCHSGVRPLCLPGAG
DESLRLQLSMDPGKSGEFRLAIQSTSGTGQSVTINEFDLRSINYEVKSPKCHELISVAPP
CDRISFNFSSEQEAEGWATVVMSSLREAHRATPQENGLQHLFDGLHLRNTSALQQTEDAC
IELKKAIEAGDMQSASVFAASLARRQAALKIQPSTKTYEETEINLAVIVEDSSSSCCITV
KVFPHMTTASLKQQMFLEYGFHPRVQRWVIGQCLCADLRTLASYGVRQDGDTAFLYLLSA
RHSRLTLQVLQKDQESALLFSPPSSFQNPSLPAAFTNGPLSHDGRPFSTLPPRLHRTSNN
GGSERPNIGNIRDPIIFEMSRLNHNTPSSQGWSCPSCTYINKPTRPGCEICSTNRPENYI
IPGGHQPDPLELRRILQEKESIRQYQQAKEQERRENFDRLVKMDGQDLVPNPEPVDCKIC
FVDLQSGEGVLLRECLHCFCKECLRSIIMLCEEPEVSCPYRDDTYACPWALQEREIRALV
PLEEYERWLQRSLSVAESRCEGSYHCATPDCPGWCVYEDTVNVFHCPICRKHNCLICKAI
HEGMNCKQYQDDLAARAINDSAARRTTHLLKTLVQSGEAMHCPQCGIIVQKRDGCDWLRC
TVCHTEICWVTRGPRWGPKGPGDTSGGCRCNVNNQKCHPKCQNCH
Download sequence
Identical sequences M4AX22
ENSXMAP00000019017 XP_014328326.1.87360 ENSXMAP00000019017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]