SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000019035 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000019035
Domain Number 1 Region: 406-539
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.18e-34
Family DEP domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-24
Family DIX domain 0.0023
Further Details:      
 
Domain Number 3 Region: 231-342
Classification Level Classification E-value
Superfamily PDZ domain-like 1.33e-23
Family PDZ domain 0.0000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000019035   Gene: ENSXMAG00000018981   Transcript: ENSXMAT00000019063
Sequence length 686
Comment pep:novel scaffold:Xipmac4.4.2:JH556675.1:1794347:1809418:1 gene:ENSXMAG00000018981 transcript:ENSXMAT00000019063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETKIIYHLDDQETPYLVKLPVPADKVTLADFKNVLKKPNYKFFFKSMDDDFGVVKEEI
SDDNARLPCFNGRVVSWLVSGDGAHTDGGSVADSLEQTPPLERTGGIGDSRPPSYHGKAA
SGRDSLDNDTETGSIVSQRRDRDRERPRRKHTNDHGGRQNGYSSRTMGRGAADYDSCSSF
MSSELESTSCFDSEDDDATSRFSSSTEQSSSRLMRRHRRRRRKPKASNIDRSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNDINFENMSNDDAVRVLRDIVHKPGPITLTVAKCWDPNPRSCFALPRSEPIRPIDPAA
WVSHTAAMTGVYPPYGMSPSMSTVTSTSSSISSSIPETERFDDFHLSIHSDMATVAKAMA
CPESGLEVRDRMWLKITIANAFIGSDVVDWLFHHVEGFSDRREARKYASNLLKAGYIRHT
VNKITFSEQCYYVFGDLCGNMAHLSLHDQDGSSGGASDQDTVPPLPHPGAAPWPMPLPYQ
FPIPHPYDLPQPFHGGPAAGSAGSQHSGSSGSNCSKHEGRKSGGSGSESEIRSHRAPSER
SVAPPSERSIRSSVSHRSAISHSIVYGPGLVYGPPGLPPQPTHLSTAAPGAPQGRELTSV
PPELTASRQSLRMAVGNAGEFFVDVM
Download sequence
Identical sequences M4AX40
ENSXMAP00000019035 XP_005797199.1.87360 ENSXMAP00000019035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]