SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000019215 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000019215
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.33e-37
Family DBL homology domain (DH-domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 227-411
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.36e-22
Family BAR domain 0.02
Further Details:      
 
Domain Number 3 Region: 565-629
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-18
Family SH3-domain 0.00064
Further Details:      
 
Domain Number 4 Region: 467-531
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000184
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000019215   Gene: ENSXMAG00000019168   Transcript: ENSXMAT00000019243
Sequence length 641
Comment pep:novel scaffold:Xipmac4.4.2:JH556891.1:91751:109793:1 gene:ENSXMAG00000019168 transcript:ENSXMAT00000019243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEELVQSEKSYLKMLQICTVNIRNSLNNLQPPPPDLDSLFLYTEEVMNVSSRLLSKLEQK
QLKPQNPEFLENLCASFLSLSSEIEAAYKEYLWNYNHVSLVENDYKQNEALWSDIIKVVK
SAAPEVNATSLSFFLVMPVQRIARYPLLLQTIQKHTDPSHPAYALLEQTANTSIALNCNI
NEYKRFREVADKYKKTENLTIMDKINRLSTHSIAKKTARFSQYIKHETGMAPKLVDEEFD
TLEGFFNILEYGILVLLENVETYLFHLQLFSAPSICRMSQQQIEVIHIDLNNFRQWILPM
FEKRMRTLIHKPLCELRDMLVGPKNLIRKRLHKLLDYEVIEGKPKLSYEEQAVANAYKTI
NTLLLNELPCFNGLALQMIWGMLGTFSCLHRDLAADMEQLFQGFALQLPHSSCHPKEFQE
WVETAVLEGARNLDILCQSVQETLNSPVVQPLSPSCQRLLKHLTDKHGSGKIFQVTNTVV
GTRDFDLTLTKGEFVALISEFDTRGDKRRWLVDSGAKKGYVPSSKLIRYHQAAEDPPPSP
FLPTSGNMMAFRRHSCIPDPQLIHVTSQPLFQVVAAYDFMARGNHEVSVRAGEPVRVLES
QDKRGNSEWSLVEARGQRGYVPSNYLTRMPVGTGSLAPPLH
Download sequence
Identical sequences M4AXM0
ENSXMAP00000019215 ENSXMAP00000019215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]