SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000018 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000018
Domain Number 1 Region: 323-568
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-59
Family Voltage-gated potassium channels 0.00048
Further Details:      
 
Domain Number 2 Region: 197-293
Classification Level Classification E-value
Superfamily POZ domain 2.07e-26
Family Tetramerization domain of potassium channels 0.00000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000018   Gene: ENSXMAG00000000018   Transcript: ENSXMAT00000000018
Sequence length 648
Comment pep:novel scaffold:Xipmac4.4.2:JH556801.1:375181:377658:1 gene:ENSXMAG00000000018 transcript:ENSXMAT00000000018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFAMVGXSHLPYGYAQARARERERERERQAAQSRAAAAAAAAAADGGSCAEVGAGGPTS
ATSSGAHLLNNRQHQSRAASSSANQQQHRVLRERKKQRGVGRWRRNRSTLGGDLRHSELA
LLGSEEDIMIEEEEAEGAEEEEEEEEVEGGEAAEGGRGSKRSSFLCNMDDEEETVSITDR
RPQSGYENVYSECGCCERVVINVSGLKFETQLKTLTQFPDTLLGDPDKRIRYFDPLRNEY
FFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFSEEVKFYELGEEAILKFREDEGFVKEE
EKPLPEDEFKRQIWLLFEYPESSSPARGIAVVSVLVIVISIVIFCLETLPEFRDEKEYLQ
PRHNSSQPDHGFTPFNDPFFIVETVCIIWFSFEIIVRFFASPSKTAFFKNIMNSIDIVSI
LPYFITLGTDLAQHQGNGQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMR
ELALLIFFLVIGVILFSSAVYFAEADEPTSQFTSIPDAFWWAVVTMTTVGYGDMKPITVG
GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDNEDQSPVVESMPPGCPYFPDFLRK
FKDKGEYMEMEEGVTESLCGLDKSPSKGNGTDISRKNSTNSKSIQTDV
Download sequence
Identical sequences M3ZCS6
ENSXMAP00000000018 ENSXMAP00000000018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]