SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000042 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000042
Domain Number 1 Region: 261-455
Classification Level Classification E-value
Superfamily Nudix 6.77e-44
Family NADH pyrophosphatase 0.0015
Further Details:      
 
Domain Number 2 Region: 19-98
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.33e-16
Family Ankyrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000042   Gene: ENSXMAG00000000042   Transcript: ENSXMAT00000000042
Sequence length 460
Comment pep:novel scaffold:Xipmac4.4.2:JH557113.1:89128:97926:1 gene:ENSXMAG00000000042 transcript:ENSXMAT00000000042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLQLSAKEEMLEKFLDAAARGDLSQVSTLLSNAPSLINQTGHSGWTALMLAARNGHHH
VAEKLLLLGCDKFSVNSSSQTAYDIATFWGHRHIAGLLGRAADGCGRILPGADLHPHENY
FSRETLDRQSGRRTDKVWLEAKQSDSETVYLLFSNLSPMVRTQQQDGSEAQGDMKLCLFR
FEEVKDLLLKPSSVTIFLGIEKTKSPSSSSSSEKAESLSEPPVWFAINTDEDAAALLERC
REKNCSFPRSPNRDLLKLSEEEAGVVAQARSVLAWHSRYSFCPTCGGATKMEEGGYKRSC
LNSECRSLQGVHNTCYPRVDPVVIMLVIHPDGNQCLLGRKKVFPVGMFSCLAGFVEPGET
LEEAVRRETEEESGVTVGPVQYVSCQPWPMPSNLMIGCLAVAVSTDIKVDEKEIEEARWF
PRQQVIDSLFRGDRSVFVIPPRQTIAHQLVRHWICMNSNL
Download sequence
Identical sequences M3ZCV0
ENSXMAP00000000042 ENSXMAP00000000042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]