SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000960 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000960
Domain Number 1 Region: 109-303
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.94e-59
Family Astacin 0.0000956
Further Details:      
 
Domain Number 2 Region: 730-842
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-37
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 3 Region: 426-528
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-37
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 4 Region: 310-419
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-35
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 5 Region: 575-685
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-35
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 6 Region: 866-959
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-29
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 7 Region: 684-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000134
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 8 Region: 530-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000753
Family EGF-type module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000960   Gene: ENSXMAG00000000900   Transcript: ENSXMAT00000000963
Sequence length 970
Comment pep:novel scaffold:Xipmac4.4.2:JH556886.1:12865:49332:1 gene:ENSXMAG00000000900 transcript:ENSXMAT00000000963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSARCLFLLSCLGVILAIDLEAIDPGYYVEPSATSEAIDYKDPCKAAAFLGDIALDEE
DLKSFKVDRIINLAQRTVQTINHTDTDSVSSSDPNRQGAQRRKRAATSRPERVWPEGVIP
YVISGNFSGSQRAIFRQAMRHWEKHTCVTFIERTQEESYIVFTYRPCGCCSYVGRRGGGP
QAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIIRDNIQPGQEYNFLKMEPGE
VDSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNGVRPPIGQRTRLSKGDIAQARKL
YKCSKCGDSLQDSSGNFSSPGFPNGYSAYMHCIWRISVTPGEKIILNFTSMDLYRSHLCW
YDHVEIRDGYWRKAPLKGRFCGDKLPEPIISTDSRLWIEFRSSSNWVGKGFSAVYEAICG
GEVKRDNGQIQSPNYPDDYRPNKVCIWKISVAQGFHVGLTFQSFEIERHDSCAYDYLEVR
DGLSETSPLLGRFCGYDKPDDIKTSSNHLWMKFVSDGSVNKAGFAANFFKETDECSKPDN
GRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFITKLNGSITSPGWPREYPPNKN
CIWQLVAPTQYRITLLFDVFETEGNDVCKYDYVEVRSGLSADSRLHGKFCGAEKPEAITS
QYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHECVNTFGSYSCQCRSGFVLH
ENKHDCKEAGCDHTVNSVSGVITSPNWPDKYPSKKACTWALTTTPGHRIKIAFNEIDMEA
HLECAYDHIEIYDGRDAKASSLGRFCGSKKPPPIISSGNKLFIRFFSDNSVQKKGFEASH
TAECGGRLKAEVKTKDLFSHAQFGDNNYPGASDCQWVISAEKGYGVELIFQTFEIEEEAD
CGYDYMELFDGADIKSPRLGRYCGSGPPEEIYSAGDSIVIKFHSDDTINKKGFHVRYTST
KFQDTLHSRK
Download sequence
Identical sequences M3ZFG8
ENSXMAP00000000960 ENSXMAP00000000960 XP_014327790.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]