SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001068 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001068
Domain Number 1 Region: 19-398
Classification Level Classification E-value
Superfamily L domain-like 5.44e-65
Family Ngr ectodomain-like 0.071
Further Details:      
 
Domain Number 2 Region: 597-681
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000676
Family Fibronectin type III 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001068   Gene: ENSXMAG00000001079   Transcript: ENSXMAT00000001071
Sequence length 820
Comment pep:novel scaffold:Xipmac4.4.2:JH556743.1:1834507:1837135:-1 gene:ENSXMAG00000001079 transcript:ENSXMAT00000001071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLVGICLFLLSLGGFSSSSPVLDFCPERCDCVHALHLLCANRGLRAVPRAAARVSVDAL
ILSLGGNFITNISASDFARYCKLVRLNLQYNQIAAIHPQAFEKLSRLEELYLGHNLLTAL
PAGSLQSLNKLSTFYGNDNAIKKVLPENFLNLDNLVKLRLDGNSLEVLQDSVFTNLANLQ
YLHLEHNKLHHIHRNAFLKLTNLRFLNLAHNKLSALTNVLSFSHLRSLTVLLLSENEIRH
IGNHVFQNLKKLSKLSLSNNRISGVDRDGLRGLSSLREFLIDGNELEEINAGWLDPLERV
EVLDFSHNRLVSVDPSAFSRLTYLKVLRLKNNFLTSLSGDIFAFNSVLQNIDLHGNNWTC
DCRLEDLKRWMTAAHSQRKLLSVFVQCHYPETLRGKYLDYVNSSQLHPLGNWNHSCKSGS
GPEDSQGGGLSKKLDGKDRTKLDREGKGEENWIELGDRNKTELGERDGLRQLNRGGIVTR
REGEKRKRGGQEEVEIQGDQGGLEAAEPSILKGKQTKKESRPATETAGRRTKGSQRSNVI
PKIDPLVTSKPSHPTNTWLTTSEPVQPGEKFDLLRSDRDEALPVISDPCVFNRHFITNVS
VDQVTSSTVTVYWTSRDNHRYSPGPKPGLHEVHYRILFDRFGNPDRFPRYVYAGRGSRSV
TLRELTSGVTYVVCVEGVVGGFVCHVAPRDHCAGLVTLPEVASRQSSTSLTSDLQLVTVV
TLVGNALLLLVISGIWLGRSLRKRLQKRKSAVHVRHMYSTRRPFRPTVAATSVSTDFTSY
QSSRARLAPLEEGDLIEFPCDRFLDNCGVRRDGNMQRFSD
Download sequence
Identical sequences M3ZFS6
ENSXMAP00000001068 ENSXMAP00000001068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]