SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002078 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002078
Domain Number 1 Region: 224-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000316
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 2 Region: 103-165
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002078   Gene: ENSXMAG00000002078   Transcript: ENSXMAT00000002083
Sequence length 354
Comment pep:novel scaffold:Xipmac4.4.2:JH556701.1:1291094:1294171:-1 gene:ENSXMAG00000002078 transcript:ENSXMAT00000002083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRWDQPAQPKKSVDVQQQKSIGNATLPVAAEETPTGGVEKAAAMAAKINAMLMAKGKLLT
PPPLLPKVHSKPPSIPVPTPVEEMVVTEVDINDVPLNCRELLTKGKTQEEIRLFSGAVVS
TKGLYMPEIEKGAGGQRPLYLHVQGKTQEQVNKAVMRIKEIISEDVIRASAASGGQQVPV
IPPLTLYPQPPRPVIPTPVPQSSRPFNGGKSFVHTKIFVGLDQALPSFNVKEKVEGPSGS
YLSHIQTETGARVFLRGKGSGYIEQASKRESFEPLYVYISHPNAAGLESAKKLTESLLET
VRAEHAQMVSVYTTTGATQPYAAHGFPTNSSYSSQGSWYNYPANGYAGGYAAYP
Download sequence
Identical sequences M3ZIN6
ENSXMAP00000002078 ENSXMAP00000002078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]