SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002597 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002597
Domain Number 1 Region: 654-959
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-81
Family Protein kinases, catalytic subunit 0.00000000181
Further Details:      
 
Domain Number 2 Region: 29-200
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.44e-72
Family Ephrin receptor ligand binding domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 326-372,419-563
Classification Level Classification E-value
Superfamily Fibronectin type III 8.17e-43
Family Fibronectin type III 0.000019
Further Details:      
 
Domain Number 4 Region: 955-1030
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.28e-19
Family SAM (sterile alpha motif) domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002597   Gene: ENSXMAG00000002557   Transcript: ENSXMAT00000002602
Sequence length 1033
Comment pep:novel scaffold:Xipmac4.4.2:JH556685.1:114844:243938:1 gene:ENSXMAG00000002557 transcript:ENSXMAT00000002602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDPGLAVILLWTISLRAVGAAGTSSNEVNLLDTTTITGDWGWLTYPSHGWDAINEMDE
YFTPIHTYQVCNVMSPSQNNWLRSGWIPREGARRIYIEVKFTLRDCNSMPGVLGTCKETF
NLFYYESDRAVGSAIRENQFIKIDTIAADESFTGVDLGVRRLKLNTEVRGVGPLSRRGFY
LAFQDIGACIALTSVRVYYKRCVGVSRNLAVFTDVVTGADSSSLVEVRGQCVDHAEERDT
PKMYCSAEGEWLVPIGRCVCSAGFEEHRDSCVACEVGFYKPVAGDGPCGKCPQHSHSETR
AAVSCPCDSNYYRAADDPPAAPCSRPPSAPVNVISSVNGTSVVLEWDRPLDTGGRSDLQY
SILCQRCSGDGPCEDCTASPGGSSGGKVGGGASIGLGGGGIVERSGSAAVRFIPRQSGLT
ESRVTVLNLVAHTNYSFRILATNAVTHLSNEASPYTVVNITTNQAAPSEVLSIRQENASQ
NSVTLMWHEPDQPNGVILEYDLKYYEKDNEEQSYSTLKTRNTSALVSGLKPGTKYIFQVR
ARTSAGCGRFSQNVEIQTGKAAPLRYNTMTIIWISMALVSGLVAFLAIIICRKRQGYTLP
HYPSLLHCGYSKAFQDSDEEKMHYQNGHVSFPDARFYIDPHTYEDPCQAVHEFAREIEAS
RIKIEKIIGSGEFGEVCYGRMRLPGKRDIPVALKTLKAGYTEKQKRDFLAEASIMAQFDH
PNVIRLEGVVTHSKPVMIITEYMENGSLDAFLRRHDGQFTIIQLVGLLRGVAAGMTYLSN
LGYIHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPDAAYTTSVSFHIEGGKIPIRWTAP
EAIAYRKFSSSSDVWSYGVVMWEVMSYGERPYWNLTNRDVIKSVEEGYRLPAPMGCPAAL
HTLMLDCWQKDRNERPRFCQIVTVLDKLIRNPENLKSMDTLCSLSSPPLMARAIPDFSSC
NSVDEWLDTIKMGRYKEHFAAGGFHTLGHVISMKQGDIQRLGVTLMGHQKKIMTSVQLMR
AQVLNKSVPSVHV
Download sequence
Identical sequences M3ZK55
ENSXMAP00000002597 XP_014323968.1.87360 ENSXMAP00000002597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]