SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002621 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002621
Domain Number 1 Region: 14-88
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2.09e-16
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002621   Gene: ENSXMAG00000002623   Transcript: ENSXMAT00000002626
Sequence length 508
Comment pep:novel scaffold:Xipmac4.4.2:JH556715.1:1392611:1397543:-1 gene:ENSXMAG00000002623 transcript:ENSXMAT00000002626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAATATPRVMRDRLLKAIDGQSNIRNMVVVVEVISSLEKYSITKEVLEETRLGKLINDI
RKKTQNEDLAKRAKKLLRTWQKLIDPGQGGSVSKELTGASWSSKGSIHPCSSPPALSKTG
SELKARSDFNNCSPNPEPISNRKRRCDKKEGQTKKPKVAHDDIKQQPSNGLSGSFKIPAN
TNAHQPSDKDASKYLDNSKSNKVPIHAVKPHPSASVYSNPANTLMQQQVRWDKHQTRSPG
CLLQHPESLKQEAVIKKPQSSENPGVKVEESAQSLNVHTNHSGSANLEFQSRTSGLDDET
VINDAVNKKREKYRAKDYVVNLNDPITEDKSKPVRLKDRRITFDPSTGQIKRTCPKESSE
EQEVSELQLKSNQPIPPSPFQQTDWKELSRSEIIQSYLTQQSNILSSSGAHTPGANLFMS
EVCKRADHQKRHTTETSILVSDHHVKELPGVSREISSEDLNRLQRQRWSGVNGCYDTKGN
WYDWTECISLDPHGDESRLNILPYVCLD
Download sequence
Identical sequences M3ZK79
ENSXMAP00000002621 XP_005800941.1.87360 ENSXMAP00000002621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]