SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002924 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002924
Domain Number 1 Region: 244-479
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.11e-53
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 85-191
Classification Level Classification E-value
Superfamily POZ domain 1.15e-25
Family Tetramerization domain of potassium channels 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002924   Gene: ENSXMAG00000002918   Transcript: ENSXMAT00000002929
Sequence length 513
Comment pep:novel scaffold:Xipmac4.4.2:JH557753.1:6845:14760:1 gene:ENSXMAG00000002918 transcript:ENSXMAT00000002929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLNHLRARSRSLFCSYKPGGQNHQLQEPIDHLDLISSFIKPWNSMQDLSRDIYDLYAEYE
REEVEDRLPVSPSHVLMSPTKHLTLNINVGGTVYLLPYRLAARYPKTRIGRLATYTDHSK
KLDLCDDYIVQSNEFFFDRDPKVFHNIFNFYRTGVLCIKEELCPHHFLEEIHYWGVRIKY
THRCCRISFEERQDELNEQLKVQKELLAELELEESDAMFDHMTFGPTRRKIWNLTEKPFS
SITAKLMGVASSFFVLVSLVAMTLNTVDEMQYKPSGRFYGEGIETLCITFFTLEYLLRLV
STPDLKCFMRSVLNTVDLVAILPHYLQMLLECFEDEDVHRHAGDIETVARVGKVGQVLRI
MRLMRIFRILKLARHSTGLRAFGFTLRQCYQQVGCLLLFIAMGIFMFSAMVYSVEHDVYN
TNFTSMPHAWWWAAVSISTVGYGDMLPETNLGRVFAFACISFGVILNGMPISILYNKFSD
YYTKLKSHEFAMVSRARGKIRFIKRAAKRFADC
Download sequence
Identical sequences M3ZL32
ENSXMAP00000002924 ENSXMAP00000002924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]