SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003121 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003121
Domain Number 1 Region: 84-356
Classification Level Classification E-value
Superfamily L domain-like 5.67e-50
Family Ngr ectodomain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 440-512
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000498
Family Fibronectin type III 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003121   Gene: ENSXMAG00000003117   Transcript: ENSXMAT00000003126
Sequence length 683
Comment pep:novel scaffold:Xipmac4.4.2:JH556827.1:302081:304246:1 gene:ENSXMAG00000003117 transcript:ENSXMAT00000003126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELRDWLFLLLLVLTLLAEVLELAAAAIAMETGEGDEGIVCPSVCRCDEGFVYCNDRGLSI
IPPLPLTAAILYLQSNRLSNAGLPQSLERSTSIRVIYLYANQLDEFPIHLPPSLKELHLQ
DNNIRTLPRSALAKLPLLERLHLDDNSISTVSIQDRAFSGTPRLRLLFLSRNHLSSIPAG
LPASLEELRLDDNRISTIPTHAFRGLSSLRRLVLDGNLLANTRIADDTFSRLSNLTELSL
VRNALQSPPVNLPSAHLVRLHLQDNGMTHIPRATLDGMKRLQRLDLSGNNLTSLPRGILR
DTESLELLLLRGNPWNCGCNLRWLHSWLHGRGSAVTVRGLVCQGPESVRGQSLRELTSLM
EQCEGPPAGSSPGEVVNPVENDGGGEDDVGESQVVPHGTTTTAPLLVPTQGSLFTLRPKW
PGLIMPLPPGEGGQVSGEAFELTVKPLSSDSVLVSWLYPQPAPSFRLSWLRMGSSVALGS
MTETLVAGEKRQYLLNQLTPRSRYLICLLPLRQEASFGKDSAPACAQIETGDVSSGGDGA
DKEGQDSELTALPLAGIIGGATALVSLLLIFAIFCWYGQRSGYMSGDSGSYSRGRGGKHY
DDYVESGTKKDTSILEIRAPPAGFQMTAMAHQSLQPKLEDVTYIHTIFPSSSSSSQASHH
HVTYGTNRGYREGGIPDIDYAYT
Download sequence
Identical sequences M3ZLM9
ENSXMAP00000003121 ENSXMAP00000003121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]