SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003562 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003562
Domain Number 1 Region: 5-82
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000000706
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003562   Gene: ENSXMAG00000003555   Transcript: ENSXMAT00000003567
Sequence length 178
Comment pep:novel scaffold:Xipmac4.4.2:JH556952.1:170285:183984:-1 gene:ENSXMAG00000003555 transcript:ENSXMAT00000003567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELIGNRYKGKIKNGRMEGDGEYTFPTDTKYVGEIKDGKFHGKGVLYFTNGSQYKATWEE
GIAIDGTFIFPDGLVYRNKNWDYCDGYDRRFYTERCYGFIPPGETQLTNVHPPPLIPDGC
YDCADGFYDPKIRVITTYSGEFLRNADDNEHEWIVSTCRRAWDVPLTDIPLQTSCKQI
Download sequence
Identical sequences M3ZMW9
ENSXMAP00000003562 ENSXMAP00000003562 XP_005810069.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]