SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004521 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004521
Domain Number 1 Region: 397-649
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-37
Family YWTD domain 0.0000281
Further Details:      
 
Domain Number 2 Region: 301-384,643-686
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000102
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 221-258
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 4 Region: 182-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 64-100
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 24-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 142-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000128
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 109-139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 265-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004521   Gene: ENSXMAG00000004512   Transcript: ENSXMAT00000004526
Sequence length 690
Comment pep:novel scaffold:Xipmac4.4.2:JH556733.1:681038:685291:1 gene:ENSXMAG00000004512 transcript:ENSXMAT00000004526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGQLWLCVGLLALFLQAAGSCLNRCRMGYSLCKDGLECISYNHVCDGEEDCKDGSDEQN
CEAGCSADQFQCAHGKKCIDKDQVCDGVPQCQDRSDEQQCRKHPEDCAHHCDEKSHCLPA
NFICDGEKDCLDGTDEANCASIVCGLGSQMCKDKSDCVHYNHVCDGEPDCRDGSDEEDCI
SECGTDQFQCAHGRKCIERSKVCDGEPQCQDRSDELDCAKRMCSSTEFKCLSGQCVLASM
HCDGHPDCWDRSDEDGCTKPLVCTTKHRCPHSKECLVQEWLCDGDQDCKDGSDEKEFQCG
SQECLDPVLVCNGITNCADGSDERCRCTAGYRLMEDGQTCADVDECDDQAQSVCSHLCIN
AAGSYKCECQPGFIMEADEYQCKITGKASKHSGGRNKTELYMYGLRTGSLDVLSSSAKRA
ILSIDYDWRDQKVFWVGVDTETIRWSSMDQKTTGILTKGVRADSVAVDWLARNLYWIDGV
KSQIVAISLTKAPVKSLDQSIILDEELDQPRSLALLPQKGLMFWTEIGNLVKIERAGMDG
SERKAIVNTSLGWPGGITVDVLSERVFWTDERLNAIGSSTLDGDNVKIFQLKETTNPFSV
AVFNDLLYWSDAKRRVVQAVDKLSGRNRQVILKRPGQPFAIKIIHPIMQMDTESPCKKMA
CSHMCVLAPRRKAVCKCPSGLSLAEDGLLC
Download sequence
Identical sequences M3ZQM8
ENSXMAP00000004521 ENSXMAP00000004521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]