SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004554 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004554
Domain Number 1 Region: 52-156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-33
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 173-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-20
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 3 Region: 295-331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000111
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004554   Gene: ENSXMAG00000004546   Transcript: ENSXMAT00000004559
Sequence length 556
Comment pep:novel scaffold:Xipmac4.4.2:JH556731.1:1553995:1562650:1 gene:ENSXMAG00000004546 transcript:ENSXMAT00000004559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAVWIFLLFTKEGFSLAQKIKDGGAGPKGSRPPEQSRNNRHCGTWVRKSDGGSFSSPNY
PNTYPPNKECLYVLEALPRQRIELQFSKIFQIEASFECRFDHIEVRDGPFSFSTLINRYC
GTANPGRILSSGRFMWIRFYSDDELEGKGFQVQYTFTADPEFHLHVGGLLNPIPDCQYEL
TGFDGVIRSHQVEEENKVKLDQAVDCIWTIQAPMKSRIYLKFLEYQMENSNECKKNFVAV
YDGSSAIEDLKAKFCSTVANDLMLETGFGVVRMWADETSRLSRFKILFTVFSDPPCIGGA
FFCHSNMCINNSLVCNGVQNCVFPWDENNCLEKKSKVPFLQITKTQGTIICISTGVVMLL
LIFSIMVQVKQPRKKVVIRKKKLFQHPHLQKMFDPQHYELFSIRDKEMSGDLRNLSEELL
SLQALRRSSSGSRCVHEHHCGSQGSINSIKPSHSSNVLRKTSLELAPFRRDTQTAAPPFR
GINNSSRKKSWPSLKQSQMQSHPAIRDRVLWQQDRVMEEDDEEEEEEGRYDLYVRRAGSR
RGKYDMTQQRSHSMDF
Download sequence
Identical sequences M3ZQR1
ENSXMAP00000004554 ENSXMAP00000004554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]