SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005288 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005288
Domain Number 1 Region: 847-923
Classification Level Classification E-value
Superfamily DEATH domain 4.37e-17
Family DEATH domain, DD 0.00011
Further Details:      
 
Domain Number 2 Region: 151-241
Classification Level Classification E-value
Superfamily Immunoglobulin 8.63e-16
Family I set domains 0.046
Further Details:      
 
Domain Number 3 Region: 241-293
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000196
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 4 Region: 294-349
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000445
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 5 Region: 44-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000393
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005288   Gene: ENSXMAG00000005223   Transcript: ENSXMAT00000005294
Sequence length 925
Comment pep:novel scaffold:Xipmac4.4.2:JH556890.1:173735:396872:-1 gene:ENSXMAG00000005223 transcript:ENSXMAT00000005294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQFSGGCCWSFSILVLLGLQVPATLARGPRGEALQHGQSGTLPRFLEEPVDAYIIKSNP
IKLRCQARPALQIFFKCNGEWVHQSQHMSQEHTDVVTGLKIREVMINVSRQQVEDFHGPE
DYWCLCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGTEVPLNGMIVLHCRPPEGVPVAE
VEWLKNEESLNVGADGVISKKSDHELIVSEARLSDSGNYTCVASNIVAKRRSATAMVVVY
VNGGWSSWSDWSACNVRCGRGVQKRSRTCTNPAPLNGGAFCEGMSVQKSTCNTVCPVDGG
WGEWSEWSVCSSDCDRQHARECTAPEPKHGGRLCDGAASAAENCTGGLCTQNRKLLHDAK
PQGVERTSDVALYSGLAAGVVTVVLLIVAVTLYRRSQSEYGVDVIDSSALTGGFQSFSFK
TSRQANPLLMNSSMQPDLTVSRTYTSPICFQDSIDKELMAEHSLLDPLPDLKAKVISPFI
VSAGATERAEYHVMSHPQTFPRGLAPDYRGVAVGTTLGRRGKNLFTPRVFQTLSRPLHKA
TAVFGHAGGRLVLPNTGISLLVPHGGIAEDTTWEMYMSINQEDSSTVPEDGAEIFLSPAV
TYGPPGLDLSCPIAMTIAHCAEVAADNWTIRLKRQIQDKWEEVMSVDEESTSCYCLLEAQ
TCHVLLEQPGRYALVGEALNQEAGKRLRLAVFGSPDLSNSLGFTLRVYCVDDTPYAFQEV
VVGERSRGGRLLEEPKILLFKGNTFSLQVSIQDVPRLLWSIKPFTTCQEFSFSQVWASNR
CPLQCAFSLERYSLSSSQLSCKISVRQVTGEEQILQIYTSVVENEKGAVPFFTQSDCTIT
SQTGSKAFKIPPSIRQRISATFDTANANGKDWQLLAQKLHIDRNLGYFACQQSPSSVILS
LWEAQHQDPGDLDSLASALEEIGKV
Download sequence
Identical sequences M3ZSU5
ENSXMAP00000005288 ENSXMAP00000005288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]