SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005673 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005673
Domain Number 1 Region: 885-969
Classification Level Classification E-value
Superfamily DEATH domain 2.05e-22
Family DEATH domain, DD 0.0000313
Further Details:      
 
Domain Number 2 Region: 191-282
Classification Level Classification E-value
Superfamily Immunoglobulin 3.84e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 279-333
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000262
Family TSP-1 type 1 repeat 0.00078
Further Details:      
 
Domain Number 4 Region: 335-389
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000085
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 5 Region: 84-186
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000182
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005673   Gene: ENSXMAG00000005624   Transcript: ENSXMAT00000005679
Sequence length 975
Comment pep:novel scaffold:Xipmac4.4.2:JH557006.1:224167:297608:-1 gene:ENSXMAG00000005624 transcript:ENSXMAT00000005679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSRAFKPASSCGQRPCRTGAPLGAEAQPKKMRPLRMQRDQIAGPLVLLLLVCGFVASDT
ESSDYSEAEVLPDSFPSAPAEPLPEFLLEPEDAFIVKNRPVQLRCRASPATQIYFKCNGE
WVNQNDHVTRESLDQLTGLVVREVDISVSRTQVEELFGLEDYWCQCVAWSSAGTTKSNRA
YVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGMPAAEVDWLKNEDIIDPSQDSNFLI
TIDHDLIIKQARLSDTANYTCVARNVVARRRSSTATLIVYVSGGWSSWTEWSECNARCGR
GWQRRTRSCTNPAPLNGGVFCEGPPVQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSR
ECQAPPPINGGKHCSGSMMESKNCTEGLCARNKKVSIEHASHPLSPGMGVAVYTGLVVAL
LLTVVMALGVGVLAYRRRCRHLHGDITDSSSALTAAFHPGNYKAPRQDNPLHPSAPPDLT
ATAGAFRGPLFSLPQGINDSPHKIPMTTSPLLDPLPSLKIKVYNSSTLSSLELPADMGVG
DGEILSLKSVGTVGREREFHSHTLSREPGLSTSATLGHLGGRLTIPNTGVSLLVPPGTIP
QGKFYEMYLIINKWDKTTLPSEGSQTVLSPVVSCGPSSMLLNRPVVLTLPHCAQLDTPTP
DWTLTLKTQTHQGAWEEVLTVGEETLSSPCYLQLEEECCHVLMEQLGTYGLVGQSCPPRP
ACKRLQLALFAPRAPCLSLDYSLRIYCIHDTPHALKEVLDLERSLGGVLLEDPKPLFFKD
SYHNLRLSIHDIPHNHWRSKLLAKYQEIPFYHIWSGSQRPLHCTFSLERASLAVSQLACK
ICVRQVEGEGQIFQLHTDIQETLPPHSPLPSGSTCLPSSQVGPYAFRLPDSIRQKICASL
DAPSARGCDWRLLARSLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEM
GKSEVLVVMTTDGDC
Download sequence
Identical sequences M3ZTY0
ENSXMAP00000005673 ENSXMAP00000005673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]