SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006331 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006331
Domain Number 1 Region: 400-663
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-54
Family YWTD domain 0.00000000826
Further Details:      
 
Domain Number 2 Region: 313-393,663-712
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 191-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 4 Region: 141-181
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00037
Further Details:      
 
Domain Number 5 Region: 24-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 61-103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 7 Region: 107-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00052
Further Details:      
 
Domain Number 8 Region: 229-270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00027
Further Details:      
 
Domain Number 9 Region: 274-310
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000654
Family LDL receptor-like module 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006331   Gene: ENSXMAG00000006284   Transcript: ENSXMAT00000006339
Sequence length 905
Comment pep:novel scaffold:Xipmac4.4.2:JH558120.1:3756:10355:-1 gene:ENSXMAG00000006284 transcript:ENSXMAT00000006339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWKPHPGFGFFLKPHDHISVTEALTQKPSQFLCGNGKSITSIWVCDGTDDCGDGTDELPG
TCVDKTCKPTEFRCTGHVTLCIPSTWRCDGETDCVSGADEQDCAAKQCSDSEFRCTSGQC
VSSSFVCDKDADCDDGSDEASCPPITCSGASFQCNNSVCVPRLWACDGDADCSDGSDEWA
QNCATRTPTRAPIHQCSLQEYQCGNGECVHVSWRCDGDTDCLDRSDEAGCAHSTCRPDEF
ECGDGTCIHGSNQCNHRYDCTDMSDEVGCINASHCDGPNRFRCHSGECVSMERVCDNKRD
CRDWSDEPLRECGSNECLYNNGGCSHICNDLKIGYECLCPAGYSLVAKRRCEGLDIDECA
NPETCSQICINHMGGYKCDCEEGYHIDPATQACKAVGTTPYLFFTNRHEVRKMTLDRSEY
TRVIPRLKNVVALDMNVATQEMYWSDLSLKKIYRTPMDSAEDFSHHNVVIGSDIDGPEGI
AFDWVHGNLYWTDSIRKTVSVVTADGSRRKTLFRQDLSKPRAIVVDPHSNFIYWTDWGSP
AKIEKGGLNGVDRTALVTDNIVWPNGITIDLLNQRLYWVDSKLHTLSSIDVQGGGRRTLI
IDEDKLAHPLGLTVFEERVFWTDVSNNAILSANRLTGGDIAPVAEHLSSPEDIVLYHNLK
QPAGRNWCQVSNSTCEFMCLAAPQIGTHPPKYTCVCPDNTMLAGDMRTCVPVSTLPAVPT
PSASSESQASTTHPPVVPTTPPKTTPPKTTQKPRVPITTTVPPIITTTATKSVRHPTRPA
VRTTTPLPKKPSPQPEKPKIFQTTTVAPVTTPGVPPKGVAVIPETTSSTSKTLYFVLPLA
ILCLVAVGGVLLWRYYRLQNTNTMHFHNPVYQKTTEDQVHIWRSQSLEGYAYPKRQIVSL
DEEAD
Download sequence
Identical sequences M3ZVT7
ENSXMAP00000006331 ENSXMAP00000006331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]