SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006500 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006500
Domain Number 1 Region: 186-392
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-52
Family DBL homology domain (DH-domain) 0.000000394
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.02e-37
Family Calponin-homology domain, CH-domain 0.0045
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-36
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 4 Region: 636-766
Classification Level Classification E-value
Superfamily SH2 domain 1.66e-27
Family SH2 domain 0.00065
Further Details:      
 
Domain Number 5 Region: 785-845
Classification Level Classification E-value
Superfamily SH3-domain 1.19e-21
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 6 Region: 592-665
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000601
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006500   Gene: ENSXMAG00000006442   Transcript: ENSXMAT00000006508
Sequence length 847
Comment pep:novel scaffold:Xipmac4.4.2:JH556760.1:1139612:1241664:1 gene:ENSXMAG00000006442 transcript:ENSXMAT00000006508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYWRQCALWLINCKVLPTNHRVTWESAQVFDLAQTLRDGVLLCHLLNNLKPQCINLKEI
NLRPQMSQFLCLKNIRTFLLACSDSFGMKKSELFDAFDLFDVRNFGKVMDTLSKLSHTSI
AQQMGVRHFPTEERVEDEDIYNHLEDLIDENGVEDEEDLYACVYEDEEGGEIYEDLMKTE
AIPPPKQAEIDIRSCCLTEIKQTEEKYTETLESIEKHFMMPLTVFFSTVEMEKVFVNIPE
LVKVHKGLLLEIQESVHQRGSQNLYQIFISFKERLLIYGKYCSHVETAITTLDDICKNRE
DVRMKLEECSKRANYGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDASEKNNLRTALDA
MKDLAQYVNEVKRDNETLREIEQYQRSIENLNQPLSNYGRPKGDGEVRVTSVDKRAKQDR
HIFLFDAAVIVCKRRGDNYEMKEVIDLHLFKITNNPTSDKENRKWSYGFYLTHNQGQNGF
EFFFKTKELKKKWLEQFGMAISNIRPENATNNFHEFRMHTFERITSCNSCHMLLRGVFYQ
GYLCSKCGLGAHKECLGRFGCCGKTALSEVEGTLQTKSKKKKQAFRTQSKHRDPGLPKML
VIRNYFGVPSPASGPALTIQTGDIIELICADLHSPWWQGRILSTKEAGFFPSDAVRPCPC
VPKPVDYSSQLWFAGPIERFQAEAELINRVNSTYLVRHRSKEFTEYAISIKYNNDVKHIK
ILTKEGFYYIAENKKFRSILELIEYYKHHSLREGFKSLDTTLQFPYREPENAAVHRFNRS
GSNMLTPKVIGVAIARYDFSSRDTRELSLQEGDVVKIYTKSGANGWWRGEVNGRVGWFPS
TYVEEGE
Download sequence
Identical sequences M3ZWA6
ENSXMAP00000006500 ENSXMAP00000006500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]