SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006707 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006707
Domain Number 1 Region: 138-455
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-97
Family Protein kinases, catalytic subunit 0.0000000000629
Further Details:      
 
Domain Number 2 Region: 16-113
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-17
Family Pleckstrin-homology domain (PH domain) 0.00000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006707   Gene: ENSXMAG00000006673   Transcript: ENSXMAT00000006715
Sequence length 473
Comment pep:novel scaffold:Xipmac4.4.2:JH556816.1:758799:773988:-1 gene:ENSXMAG00000006673 transcript:ENSXMAT00000006715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNPVSILLKLCFPISGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQAVAEGLHKQEEERMDS
SPEPMDMEVYLTKPRQKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEDIR
FPRTLGPEARSLLSGLLKKDPMQRLGGGPDDAKEIMQHKFFAGINWQDVYEKKLVPPFKP
QVTSETDTRYFDEEFTGQIITITPPGQDDSMESFDSEQRPHFPQFSYSASGTA
Download sequence
Identical sequences M3ZWW3
ENSXMAP00000006707 ENSXMAP00000006707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]