SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007159 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007159
Domain Number 1 Region: 403-664
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-51
Family YWTD domain 0.0000000257
Further Details:      
 
Domain Number 2 Region: 315-394,665-715
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.8e-22
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 27-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000929
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 4 Region: 145-185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.00052
Further Details:      
 
Domain Number 5 Region: 106-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 6 Region: 196-233
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000694
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 7 Region: 232-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 65-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000916
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 9 Region: 277-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007159   Gene: ENSXMAG00000007105   Transcript: ENSXMAT00000007167
Sequence length 857
Comment pep:novel scaffold:Xipmac4.4.2:JH556678.1:3268505:3283751:1 gene:ENSXMAG00000007105 transcript:ENSXMAT00000007167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGVWKGLSTCWCLLMLIHCLAQTDAAFTCSSTQFKCGNGRCVTRRWICDGNDDCGDGSD
ELTAVCSAKSCMESQFNCGAPLNHCIPKSWHCDGKPDCENESDERYCTAKECKTNEFRCT
NGQCISKAYVCDKDKDCSDGSDEVDCPKPTCHPRTFQCNNSICVPLQWKCDGDRDCLDGS
DEWPENCEGKQTLKKPSQCGAHDFECSNGECIHRAWRCDGTPDCSDQSDEFNCSQPSCHD
GQFQCGNGVCISEDLKCNSANNCGDNSDEVGCQTDNVCEGPTNFKCGSGECISMDKVCDS
NRDCNDQSDEPLECGKNECSTGNHSCSHQCNDLKIGYNCSCPAGYRLKSDNQTCEDIDEC
EVPDTCGQICINLPGSYKCDCNDGYQIDPVNKTCKAESGNVATLFFTTKHEVRELTVDHS
EYTRLIPELKNAVALDLDMLNKKIFWSDRSQKKIFSSNIDMASNSANHNVVIENGIEAPE
ALVVDWIHGNIYWTDSTLKTISVATTEGNKRKTLINEKLGRPRAITIDPENNFMYWTDWG
EEPKIEKCGLNGVGRVALVTDNIEWPNGITLDMVNQRLYWVDAKLHAIFSVDVNGGTRHM
IISGEENIHHPFSLTVFEEKVFWTESFRGTVSSANRLTGNDINELVTDLQNPEALVLYHN
LKQPISINWCRVGNSINGGCEHLCLPAPLLDESSPKYTCACPDNMVLAADMKKCVGAAPP
ARTDPPVMSKTSKPAKRGTTKAAKMPTTSSSVQPKQTTEKPAGTPQGFQKAVMPEEAPAS
HSVALYVFLPLGIIAALVCGAVLFWRNWHRKNTNTIHFANPVYQKTTEDEVHICRNGSDG
FVYPERQIVSMDDMEIA
Download sequence
Identical sequences M3ZY65
XP_005797628.1.87360 ENSXMAP00000007159 ENSXMAP00000007159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]