SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000008936 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000008936
Domain Number 1 Region: 626-851
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.46e-56
Family DBL homology domain (DH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 840-960
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-24
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 1013-1189
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-23
Family Pleckstrin-homology domain (PH domain) 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000008936   Gene: ENSXMAG00000008908   Transcript: ENSXMAT00000008950
Sequence length 1194
Comment pep:novel scaffold:Xipmac4.4.2:JH556693.1:444364:472386:1 gene:ENSXMAG00000008908 transcript:ENSXMAT00000008950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGVKKPPLAPKPKLPVSTKPPIAPKPCPLSQPSPSVPKRPKPAVAPKPCLPRSSGSSS
PPVSPPSLKPAEPTSLALDENLFHLNSKNGILSETESRESDYIISTCSCSAGECHPQENG
DTNGSAADFDKEPLQNGVTIGKSTEEEEETHEKGPADYKSERISKKPKDKPQRQRHLDRG
LVNKERTEEDSGVPTEAQTAEQTAACDVAGNILTSIHPLESSQAEEQTFPISTQPNLPVP
AAPSKPLPVPHPRKFKKPALVRQDGVEGQDQAVLVEEQKNETELQQADDSETQTDSCLVD
LEMDVPVPPPRQTSLSPSLHRTVRCLLNKNTSHSLDLLSRPDSEGHGKEAQQENEEEDGY
GDFERYPISHTLPKQLKLGCHRKALSAEDQQSPRAPPRKPQRHSLPATPPPSVCPPAPPH
ASTPMRDLPPPPQERTAWRFSRPYVTFFSRQIPTRSSVPPKSRAPALGGKQRAQSFSAAD
LATRAGSSQKRSLSLRKLLELRLNVKMLPKLLAKGGQSLDCTSTDKSLGRPSSCIEDPDI
HREDVEYENVPLYEEIPEYMNLPFHGARLGWPHDPDGGDANIYEVQDPFHRCSEHEYESD
WLKDDVHSEEDEMHSSDEEDNSSTSSKEHLDEADRQQEDEMKRKKVVHIAQEIMSSEKVF
VDVLKLLHIDFRDAVAKATRQNGKPVVGERILSQILYYLPQLYQLNKDLLRELEDRVAHW
SDHQRLSDIFVQKGPYLKMYSTYIRQFDNNVALLDEQCRKNPALAAVVREFEMSPRCANL
ALKHYLLKPVQRIPQYQLLLTDYLKNLPEDSEDYKDTQTALSVVKEVANHANDIMKQGDN
FQKLMQIQYSLNGQHEIVQPGRVFLKEGTLMKLSRKVMQPRMFFLFNDALMYTTPVQSAQ
YKLNSVLSLAGMKVSKPSQEAYQNELNIESVERSFILSASSAKERDEWLEAIGKAIEDYT
KKKITFISSRSQEEAECVVDSGAPLGSKAPIWIPDLRATMCMICTCEFTLTWRRHHCRAC
GKVVCQACSTNKYYLEYLKNQPARVCDHCFAKLQENSDRCASSSTSPIKSGAFSFTRKQK
KIPAALKEVSANTENSSMSGYLHRSKGNKKQWKRLWFVIKNKVLYTYAASEDVAALESQP
LLGFFLREEKNGPAQKLQFKLYHKNTLFYIFKADDIPTAQRWIEAFQEAMILEQ
Download sequence
Identical sequences M4A392
ENSXMAP00000008936 XP_005799143.1.87360 ENSXMAP00000008936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]