SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009347 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009347
Domain Number 1 Region: 122-231
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 4.18e-34
Family Elongation factor TFIIS domain 2 0.0026
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3.92e-26
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000949
Further Details:      
 
Domain Number 3 Region: 253-300
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.66e-17
Family Transcriptional factor domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009347   Gene: ENSXMAG00000009323   Transcript: ENSXMAT00000009361
Sequence length 302
Comment pep:novel scaffold:Xipmac4.4.2:JH556729.1:1585751:1590668:-1 gene:ENSXMAG00000009323 transcript:ENSXMAT00000009361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMAKTQEVERIAKKLDKMVHKKNTDGALDLLRELKNMKMSLETLQSTRVGMSVNAVRKQS
SDEEVQTLAKTLIKSWKKLLDGAEGKPDEKKKEGSLVRSTSTSKDSGSTEKSSEKSVETP
TVPHRFTSFPPAPVTTDNVRTKSRELLVAALQTGDDFKAAGVDCEHLAAQIEEQIFQEFK
STDMKYKTRLRSRISNLKDQKNPELRRNVLCGSIAPERIASMTAEEMASAELKQIREALT
KESIREHQLSKVGGTETDMFICSKCHGKNCTYTQVQTRSADEPMTTFVLCNGCGNRWKKD
FC
Download sequence
Identical sequences M4A4F3
ENSXMAP00000009347 ENSXMAP00000009347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]