SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009643 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009643
Domain Number 1 Region: 762-957
Classification Level Classification E-value
Superfamily Sec7 domain 5.36e-76
Family Sec7 domain 0.00000188
Further Details:      
 
Domain Number 2 Region: 519-702,1257-1605
Classification Level Classification E-value
Superfamily ARM repeat 3.76e-28
Family PHAT domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009643   Gene: ENSXMAG00000009585   Transcript: ENSXMAT00000009657
Sequence length 1947
Comment pep:novel scaffold:Xipmac4.4.2:JH556681.1:1209443:1263716:1 gene:ENSXMAG00000009585 transcript:ENSXMAT00000009657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKEESEKLSPPSGDGKS
GSSTLPPIKSKTNFIEADKYFLPFELACQSKCPRIVITSLDCLQKLIAYGHLTGSAPDST
APGKKLIDRIIETICACFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYN
IYLASKNLINQTTAKATLTQMLNVIFARMENQALTNHKLSWSLASRKRDRQLQEAKQLER
ERHRQQSPVAQHTEPESPQLQTHVHPPSKTPTQEANGPVSPATPSIATPSTPSTPSTPAP
ESSSSRSASGEREVQGEQPAPDENPDPENGSEFCVAENEQTEADQATAANAASKQHKGAG
EEEDEEAPNYEEKAQEIVQSILQEVVNTVAGGHCLDPANLCSDTKESTGEGEPEESPPAE
AATEGTQSSMEDEGTVGSDSEHVHANGIPGTPISASFTPSLPDDRLSVSSTDTQESGATA
GQPPGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKVLSLQLLLSILQNA
GPIFKTNEMFINAIKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSHFKTHLKMQIEVFF
KEIFLYILETSTSSYDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLS
KIAQGRGGHELGTTPQQELTLRKKGLECLVSILKCMVEWSKDQYVNPNSQTSLGQEKPSE
QDSSETKATESINRYGSINSLDSTASSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGID
LFNKKPKRGIQYLQEQGMLGTTPEDLAQFLHQEERLDSTQVGEFLGDNDRFNKEVMYAYV
DQMDFQGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVL
AYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYDEIAGKKIAMKET
KELTMKSNKQSVASEKQRRLLYNVEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMF
KLAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLL
TASSGIAEMKQKNIDTIKTLITVAHTDGNYLGNSWHEIMKCISQLELAQLIGTGVKARYI
SGTVRGKEGFITSTKEQNNDEYLGLVGGTVDRKQIASIQESIGETSSQSVVVAVDRIFTG
STRLDGNAIVDFVRWLCAVSMDELASPTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVI
GDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPT
IRDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTNVFEK
HFAATIDSFQDAVKCLSEFACNASFPDTSMEAIRLIRHCAKYVSERPQAFKDYTSDDMNV
APEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEVMKTYGHTFEKHWWQDLFRIV
FRIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYFESLNGLLLDDILAQLYWCVQQ
DNEQLARSGTNCLENVVILNGEKFSAETWDKTCNCMLDIFKTTIPHSLLTWRPAGAEGEH
FATHSLTDKQLDSISQKSVDIQSRSDDQHSISSGDRAAMESRRQSQHSSASGVFEDGSRS
RTSTKIQEQRLFSALLIKCVVQLELIQTIDNIVFFPATSKKEDAENFAAAQRDAGCAADV
QVETQDQGMFRYLTSEQLFKLLDCLLESHRFAKAFNSNNEQRTLLWKAGFKGKSKPNLLK
QETSSLACGLRILFRMYTDESRQGAWEEVQRRLLNVCSEAVAYFLALTSESHREAWTNLL
LLFLTKVLKISDERFKAHASRYYPLLCEIMQFDLIPELRAVLRKFYLRIGLVFNIAQLPE
PEPDPEPRRAEPETDMEVGEEAGEEAQ
Download sequence
Identical sequences M4A599
ENSXMAP00000009643 ENSXMAP00000009643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]