SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009855 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009855
Domain Number 1 Region: 826-910
Classification Level Classification E-value
Superfamily DEATH domain 2.83e-21
Family DEATH domain, DD 0.0001
Further Details:      
 
Domain Number 2 Region: 156-236
Classification Level Classification E-value
Superfamily Immunoglobulin 7.81e-16
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 260-311
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000314
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 4 Region: 314-368
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 5 Region: 50-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000579
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009855   Gene: ENSXMAG00000009787   Transcript: ENSXMAT00000009869
Sequence length 916
Comment pep:novel scaffold:Xipmac4.4.2:JH556664.1:4326888:4510713:1 gene:ENSXMAG00000009787 transcript:ENSXMAT00000009869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFPPGPFVRCGFSAALLLLGLMFAGITSTGGSEHPATAALPAAFSDLLPHFLVEPEDEY
IVKNKPVTLSCRSTPATQIYFKCNGEWVHQDDHLIERTVDPATALPVMQVTIEITRQQVE
KIFGLDEYWCQCVAWSTTGTQKSQKAYIRIAYLRKNFEEEPQGKEVALDQEVLLHCHPPE
GVPQAEVEWQRNEDVLDPLSDPNFFITPDNNLVIKKARLLDTGNYTCVAKNIVARRKSNS
ATVLVYGFLFIAQLQCPQKVNGGWSTWTTWSSCSAVCGRGWQKRSRSCTNPTPLNGGTSC
EGQNVQKSACVATCPVDGGWSEWSKWSACGADCSMWRSRECSQPSPGTGGKDCQGLDLQS
MNCTNEQCPQTVSGAEDVALYVGMVAVALCLTLLLIVVVLVYRRKKEGLDADVADSSILT
TGFQPMGIKPSKPENSHLLTIQPDLTTTTTSYQGTLRSRHDTAGKFSMTNGPLLDPLPNG
SHTLHNGKLNSDTTEFVSRLSTQTYFKTLPRDVANTSYGTFNFLGGRLTIPNTGISLLIP
PEAIPRGKIYEIYLTVQRKEDLRLPLAGCQTLLSPIVSCGPPGVVLSRPVILSMDHCFDA
CLDNWAVRLKKQNYEGAWEDVLLMGEELVSEPYYCQLEAETCRLFTEQLGTFALVGESLH
MGAAKRLRLVLFSDAYCSTLEYNIRVYCMDDTQDVFKEVMQMERQLGGRLIDEPHVLLFK
DSYHNLRLSIHDMPQAHWRSKLLAGYQEIPFYHIWNGSQRYLHCTFTLERLSLSTCELTC
QLCVWQVEGEGQSFALDFNIAKDTRGLDSEFLLMDSNATALAGPSAFQIPYLIRQKICGS
LDAPCPNGADWRMLAQRLKLERHMSFFASKASPTSVILDLWEAQHFHSGNINQLATVMAD
IGKQEAMIFLVSDGEC
Download sequence
Identical sequences M4A5W1
ENSXMAP00000009855 ENSXMAP00000009855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]