SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010100 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010100
Domain Number 1 Region: 205-452
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.29e-57
Family Voltage-gated potassium channels 0.00079
Further Details:      
 
Domain Number 2 Region: 36-144
Classification Level Classification E-value
Superfamily POZ domain 3.14e-31
Family Tetramerization domain of potassium channels 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010100   Gene: ENSXMAG00000010076   Transcript: ENSXMAT00000010114
Sequence length 595
Comment pep:novel scaffold:Xipmac4.4.2:JH556723.1:321773:349009:1 gene:ENSXMAG00000010076 transcript:ENSXMAT00000010114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSVCVSTYRGRKSGNKPPSKSCLKEEMARGEDSEKIIINVGGTRHETYKSTLRTLPGT
RLAWLAEPDSQGCCSESDAELPSVSEFFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFE
EELAFWGIDDTDVEPCCWMTYRQHRDAEEALEIFEPPDPEDTDDDRDTPRRFGIEDRSDR
SRGCWEVWRPKLWALFDDPYTSKAARGVAIISLFFILVSITTFCLETHQAFDVKQNITEL
VTEGNITRMEIRDETVTNPKLIMVEGICVVWFTFEFLVRIICCPNKLAFIKNTLNIIDFV
AILPFYLEMSLRGLSSKAASNVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNE
FLLLVIFLALGVLIFATMIYYAERIGVTYNPKIENHFKNIPISFWWAVVTMTTLGYGDMY
PQTWLGMMVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHTQNPDAPT
DSASFVKSETNSHIDSTQSDTCPLAAEESSSRNRSDSKQNGDANVAHSDEEGCSLTQPLS
PSEKWSLHCSRGRGKNKEGTCFILTSGEPSIHVEGCRDILGTTGNYTQPEVTTLT
Download sequence
Identical sequences M4A6K6
XP_014325136.1.87360 ENSXMAP00000010100 ENSXMAP00000010100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]