SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010789 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010789
Domain Number 1 Region: 49-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-30
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 2 Region: 169-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-19
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 3 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010789   Gene: ENSXMAG00000010764   Transcript: ENSXMAT00000010803
Sequence length 515
Comment pep:novel scaffold:Xipmac4.4.2:JH557378.1:75693:90044:1 gene:ENSXMAG00000010764 transcript:ENSXMAT00000010803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSGSPAIAASLIPPELCGSTANTKKAQVKNNSGVTPAGQCGTWVKEPSGGCFTSPNYPE
KYPPERECIYIIEASPRQCIDLFFDEKYSIEPSWECRFDHIEIRDGPFGFSPIIGRYCGQ
ESPAYVRSSGRYLYIKFVADGELEAIGFSARYNFTQDPEFEGIGELSALPACDFELSGPE
GFVESTQIAKEGKAQLTEAVDCRWYIRAPPRAKIYMRFLEYEMHNSNECKRNFVAIYDGS
SGVEHLKNKFCSTVANDVMLVTSVGVVRLWADEGSRKSRFKILFTTFHEPPCEGDTFFCH
SNMCINHTLVCNGVQNCVYPWDENRCKEKRKASILDTLDNTNLTIIGITCGLVVILLIIS
VIIQIKQPRKKYVIRSILRDDFDPALLHPGFDPPHYELCTLRRAPSGDLTDAALADDFDK
FHKLRRSESKCIRDHHCGSHQGSIHGSRSNLSLRDATIAPDGGAAVPPMSPRLATQMSPH
LSHHNTPACRRSILVMKHSYSQDGAEAYRAEDEED
Download sequence
Identical sequences M4A8J5
ENSXMAP00000010789 ENSXMAP00000010789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]