SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011143 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011143
Domain Number 1 Region: 167-254
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-20
Family I set domains 0.0055
Further Details:      
 
Domain Number 2 Region: 265-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000604
Family EGF-type module 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000011143
Domain Number - Region: 46-131
Classification Level Classification E-value
Superfamily TIMP-like 0.0759
Family The laminin-binding domain of agrin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011143   Gene: ENSXMAG00000011113   Transcript: ENSXMAT00000011157
Sequence length 738
Comment pep:novel scaffold:Xipmac4.4.2:JH556807.1:942944:1026336:-1 gene:ENSXMAG00000011113 transcript:ENSXMAT00000011157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQPTVPCRNATSPHRAKAGGMRLDPVHLSMLLIGVSFACYSPSLNSLQDQAYRSAVVIEG
KVQSTPAGNASVEPYRVSVKVLEVWPLNSGGLEREQLVTVGEFGSEAPCAKVKKNHKYIF
FMDPTDEPLVFKASFAPVDTSGKNLKKDVGRILCENCAVAPKLKPIKNPIVVGEGSKLMV
KCEATGKPVPTYRWFKDGNELTSSRKVKIKSNLSRKSSKVQINIAKLEDSGNYTCVVENS
LGKDNSTGTVNVQSITTTLSPGSGHARRCNDTEKTFCVNGGDCYFIPGINKISCNCPPGY
FGRRCSQTEPLRSYMPYPNKKHLGIEFMEAEELYQKRVLTITGICVALLVVGILCVVAYC
KTKKQRKKMHNHMRQNMCPEHPNRNLANGPNHPGPGPEEIPMVDYISKNVPATERVIRPA
TERSFPASHASSRSHNSSTRAHSSTQRHEERTWSLERSESFLSDSPGMMSSSVGTSKCSS
PACMEARARRAAHCGYSDPHRPGLQYGDSFDSLGDSPHSDRYVSALTTPARLSPVDFHYS
LPPQVPTFQITSPNASHAMSLPPAVHNPYPPEDDQPLLRRYQVPLHDAQCQEPYRQQRRT
YLKNSRGSLPSSPYRLAEEEDYETTQEYLSSREQPKTSGSSETGSRRWKRSRLNGHVAPR
GYEASRDYGSRSCLTESESEEDGESTPFLSMQNMNAEPSTIYRPVDTRTSHSSGWHSGRG
NMHTRLTQSRSKPDSTPH
Download sequence
Identical sequences M4A9J9
ENSXMAP00000011143 ENSXMAP00000011143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]