SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012084 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012084
Domain Number 1 Region: 103-404,444-718
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.09e-125
Family Acetyl-CoA synthetase-like 0.0000761
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012084   Gene: ENSXMAG00000012038   Transcript: ENSXMAT00000012100
Sequence length 722
Comment pep:novel scaffold:Xipmac4.4.2:JH556895.1:87246:125174:-1 gene:ENSXMAG00000012038 transcript:ENSXMAT00000012100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAFVLVSGSLWIILELSSTLMEKMQVQDMMSGLRIPEMDELGQFFRSLPTSTLVGIGAL
TAVLAYWFATRPRPIKPPCSLLHQSEEVPHEDGGRRSMMGDPTRLLTHYHDDARTMYEVF
QRGLHISGDGPCLGSRLPNQPYKWMSYKEVSARAEHLGSGLLHQGCQPNPDQFIGVFAQN
RPEWIISELACYTYSMVVVPLYDTLGADAIRFIINTADISTVICDKVKKAQVLLANVERK
ATPKLQRIILMDAFDSELETRGKACGVHVQGLQEVEALGREYYRTPIPPAPDDLSIVCFT
SGTTGNPKGVMLTHGNVVADFAGFLKVTDTVIFPNQDDCLISFLPLAHMFERLIENVVYC
HGGRIGFYQGDIRLLPDDMKALRPTIFPVVPRLLNRMYDKIFSQANTPVKRWLLNFAAKK
KGAEVSRGVIRSDSIWDKIFFSKIQASLGGRLRMIITGAAPTSPNVLSFLRAALGCQVYE
AYGQTECTAGCTYTTPGDWTSGHVGAPLPCNLIKLVDVPEKNYFASKGEGEVCVKGPNVF
KGYLKDPERTAETLDADGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYISPEKIENI
YIRSEPVAQLYVHGDSLQSCLVGIVVPDPEVMPEWAKKKGILGTYKDLCKNTELKKAILE
DLVRLGKANGLLSFEQVKNIYIHNEMFSIENGLLTPTLKAKRPELKEFFKNKIDDLYSSI
SM
Download sequence
Identical sequences M4AC90
XP_005808818.1.87360 ENSXMAP00000012084 ENSXMAP00000012084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]