SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012242 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012242
Domain Number 1 Region: 3614-3683
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000707
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 2 Region: 2028-2157,2195-2282
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000188
Family Extended AAA-ATPase domain 0.031
Further Details:      
 
Domain Number 3 Region: 2376-2620
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000435
Family Extended AAA-ATPase domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012242   Gene: ENSXMAG00000012142   Transcript: ENSXMAT00000012258
Sequence length 4831
Comment pep:novel scaffold:Xipmac4.4.2:JH556724.1:336963:369661:-1 gene:ENSXMAG00000012142 transcript:ENSXMAT00000012258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTIYFHAVLSKDFKFHPDDDRIFIRAGKPISNSWNDNVAELQVTRDLGEHGFLVEGSLTT
SKAKTVSESIAYKYVVYKNKKESYEYEYIYKLDSTHHHTNRCLFVKQHLITDDGKGDWHQ
YDDIICVEPSKGMLTRLKERIWPDQRKDLIQGREIAANVMLESIFDLLKSWSDTNVKSFQ
IQLNQFFQVYSNPFVFEEKQKKWYSLQFGEDDVRKILKEFMLTHVLPQLQDRAEKNLYIP
DQMRAAVIMLHIWRQYKLKLENPELLRLCSALCLPELEKDKFLQYWANFSQAVSVFKNLP
EMLVDLIKIVKRATTPRWIILLPLLHLLRGTIKPFEAKTSGNRNYSLSWAGLEGIDINNQ
THLYSQERKALINVMKNHSHLMKVDPLLVRSCLYLMPLEDQLLCSTNINPELLDILHVFT
NKVPQEITSSSSQVSENLDNSGKYVTEILAHIQEHLIEEKYRKECLTTTVRLLEKLCKGV
KPESYTQSFPEIPVAATNLVASVLDFFLSNKEQESEDADGEQQNAKDLVIYQGMEIMRNW
MNRSFKQSLLKRGLTTFYSAKTTELETWNNIISIKFKDKKCTNEWRQTFIMDFEGKFKQE
SSLDQIEFYCTNIEEFSASYPHVAASIEKCALEAVTSLCQTRSEGKLFERLKIDWKFGNL
ISAIIQKSWPRDGQGKYQEKEEVVLQHLLSWTAAKDIFHLYGADTKLIEKLSQDARDRLA
IAISAFTAIINQLIQGDIKISLLNIILERKDAFLELLKIDCLTEKEQHRDLSKMKRFLQH
RAEEVKSVYHEKELVDVILTMSHKLEEHMTVVDVSDLEDKTQVNIEMMPLNHFMEVHHFE
KLATAMSGIVTFFSLDEEIRDMATFLYKFNESIVLQMCWEKFAIQMARDEMEDVDEEIGA
TPEMIYDQIYLPCRDEYKDIYTRLKDGSIRLEEVNQLFKAYKDKYEDLTQELDIMCKQDT
SANKQWIHNRVQQVQQYHELHLAVESAKVIMMVKDTLGLQGDFEVLETLTDVVSSHIRED
FKREPLNRIDNDLMQAKMVLVDITEPRRLCLNELGLRRHFVRWVKDALEDINELKVFVDL
ASISAGENDMDVDRVACFHDAVLGYSSVLYELKPESGFRAFKDVLNKLWRALENDNNLPK
KLLDSARHLEWLKTVKDSHGSVELSSLSLASAINNKGIYLISARDVKKLSLETAVKLQIP
EEHDEGRQMRCYSLEDLRELQNKLMLMSGKGDQGQNEVERFVEVFASVQRLTEAFIALYT
AGNPLFRHWEVQINCSSSYAEPSILMDFNLGRALSVIVEGSPEEELPELCRKMEKCLEYW
MNFVHKQRSQQYFLNYYTAEQIVYLCSKLTQQNANKVEDQVLMMLSFIKPNCTSTDLSMK
SLLNPRIKMRTLSFRLLLCLVEKAKGLQAFDHIWNAYMKDMKNFLPNILDIKSLGRVLEL
LANNSGKFINRQLPRGLVNGKPNLIVCPHDDALASCISIYMSSKDEALPTYDEVLLCNHS
TPYEQVELFLRRCLGNGYRGQKIYSLVYGDLLSYDVSSKVENFFHQMKMQSRTDYRLVII
CSSEREHAYLPSAFSQYRLHMIPQEPLARIQQYLQQHYTVPSEQCSAAAAFKDRLCVGVV
SSQRAGVAGKSLYIRRMYEKLKHSTTKQSMLKCICLIEPKVDETLILSHCNNYFDRLYLI
VRGICFAPEKVQKGLPEFLFKLLVLRYLMDSEGKMWRCNDKQLYVIEILDPTVKSTGNAT
REAQMTRNTFVDMFPKIFCRPPKEVLMLEMRKQEDPTIMSSEDPLMDDKEFRSEAFQRPY
QYLTRFHNTIDLDVFTYQGVEGSHVECLQMLLMYCGVMDPSWAELRNFTWFLNLQLRDCE
TSVFCDATFTGDTLTGFKTFVVDFMILMAKDFATPSLSISDQSPGMSQVNLVGVRDEDLA
PFLIRKRWETEPHPYIFFNDDHVSMTFIGFHLQPNDQKFVDAIEPTSGRVIRKNIMTRAL
YEGLQLQRVPFNIDFDSLPRCEKIERICNVLGIQWPLDPDETYELTTDNILKMLAIHMRF
RCGIPVIIMGETGCGKTRLIKFLCELRRSGVATENMKLVKVHGGTTSEMIYGKVREAEDI
ASINKQDYRLDSVLFFDEANTTEAISSIKEVLCDKTVKGECLTPNSGLQIIAACNPYRKH
TADMIQRLESAGLGYRVRAEETDEKLGSIPLRQLVYRVQALPPSMIPLVWDFGQLNDHTE
KIYIQQIVQRVTTSKSIDQTYIKCITDVLSASQKYMRTMKDECSFVSLRDVERCMQAFVW
FHDHHEMFFSELQKFECTQNDEGNERHQRQPEAQDPVLWSLVMAIGVCYHACLENKDKYR
QKISTKLPSYTPMRVMHEISLMQDLLLSGVPMGDTIARNSALKENVFMMVLCIELRIPLF
LVGKPGSSKSLSKTLVADAMQGQAAHSELYKMLKQIHLVSFQCSPHSTPEGIINTFKQCG
RFQEGKNLNEYISVVVLDEIGLAEDSPKMPLKTLHPLLEEGCIDDEPLPHKKVGFIGISN
WALDPAKMNRGIFVSRGDPDEKELIESAKGICSSDVMVLEKVRDFFQPFARSYLNICRKQ
GKGFFGLRDYYSLIKMIFAVAKTSQRKPAAEEIVKVVLRNFSGRDDVDVVSVFTQRLKIS
PNLENINTIEFVKENIQAVGQDEECRYLLVLTKNYAALQILQQTFFSESGQPEIIFGSSF
PKDQEYTQICRNINRVKICMETGQTVVLLNLQNLYESLYDALNQYYVCLGGQKYVDLGLG
THRVKCRVHKDFRLIVIEEREVVYKQFPIPLINRLEKHYLDIHTVLKAEQKKMVEELERW
AKLFVSLTGQHAGAADMYKYTLPDVFIGYHSDTCASVILQVIEEWKDNFETSDSQRGLLD
QAKLILLKCATPDSVVRLDCTGLPKVESQHMAKVYFEEQSNSCLADYIHAHTRQETKINT
FFTEVTTFSRLLTAFDMEPLEKMFYSVELLSLQQFDTEHSFLKKIRNFLTAENGGSMTGP
CNRILIIQCDFDEPCKSTNLIASAKYSSLNEINKVTQESKGSRVFVYFITRLPRMEGGTS
YIGFHGGPWRSVHIDDLRRSKDIVSDIKTLQSMKISQMFESKTTRPEDILYVIYTNILYN
VYMCVYMITAMETDDMYMESEQEELEENLGKTMKDLDNVVDTTSLLRSCVQTAVGMLRDQ
VTSGFRSTRRVEILLTLLSDTDELRDEFLQTVKKRLHSLLLIHDGNAFMKSNWVLKEASN
IDALQEGGTFRHTLWKRVQAVVVPILAHLVSVIDRDQNMDLLLDKNCSEAVKRLWLDIFG
NEKLVEISHLAMDSRSVYETRTILVQNYIPQDRNIGCSMPFSWRIKDYLEELCVHVLQNE
GHNQLKLIEIFWSTPLGRYIEKADSETQMEFYHRYLQDFISMSMNVTSPEDLQLLCGALN
SCISELRLQLNDTEKMTALPWVHAAYHKFKNRLQNLSRIMCTEPQVTKDLLGNPHAGDNV
ELVLDVYAAFACLEHLEPKVLATDAQRQAWLRQVKKLQVPIELICSEDGVRHYGERSKMI
VLRVQSGWNRIFSLSLFVEHMLMEIEQLDTKLTPLVLENMRGLGKILEKNSDVKTQQIFE
AVIGLLKNCKDGAVERIFRFGHMVCPVCMGDPQDPLCLSCNHIYCVACIKQWLVPGQMYC
PLCMQPVEENFPLVPSNEMRIRVSQHAQFRKRCNAFFIDLVSTVCFKDNSPPSSAVIFHL
LSFLMVEASPAPLLRAKRQMLTKVLSPFDDSADKNPVVRSVVLKLLMKYSFDEVKEYLQQ
HLVAVEQSNMLDETDKTELYCMYINCLEDSMFERLQFRSAADQKAYFQNESAFLTECLQT
HGQHAEKPSVEYLQQLARVRMNLDRTASLIVESSPEGGHNGAAAFLDSVVNLCRRSGNDW
YRVYLIRKICSQYGVEFVQKRLRRGQMSWLFPEEVQLQVQCDDEETPPVDHYLVCGKDYK
TIREAVAKTVMEGKVEGLDEACEGCRCVPQLKAVYLLLALYREITTLYGHDNEGFHPTQQ
QLEALSAFIQTSKILASPEVKAFAQDLVTNRMGPLSVRPGISGAQSVAVELTVHLAAVLL
CGNQGIIAPLQQLALTPVNMQAAFLPSMPEDIVAAAQQALGPLQWYRCPNGHPCTIGECG
QPMQTSRCVDCGAVIGGDNHIAVQGFQVLAMQGDRTQTGHILGDPSRRDNPDMLDTKSMS
PVPFNVVRMLTHTAMLVGAYNHTQFISAIIKPPVPEPAAFLLNHLRKDMEHLIKSLGKGT
DETITTVHLVISSLLGPHQQQKWPVPFDNRLSNKEARNGWELEMSNAVITPQLKHLDRRL
KEVNAFIRADSRISANPIMKLVFGDPRLFLASLPANSLLHCSAVWSCREKVCVLSLTHIL
EQNDGKDTVPVLWRFLHKEAELRLVKCLPDILTLQKNLVKKFQNITELTYETINEFLHSQ
KAASLKAWYEKYIKIFLATWNQLRVSLATNGEIKIPNEFCQKDLDLNSDFKVLLPQRQGA
GLCSTALISYLIALHNDLIYCVDKHTGEETSYKVSPADLTDLHVIHYELERDLMPLILSN
TQYSIEKGQETLHEYDLFKIQQQIISRFLLGKPRITLDGIPTLVNRHDRDYKIILRDVKT
KVKQEPLQTLTLFSVAGELHSYSEVCEALSTLEVALGFLAMTGGEAHMQLSCYLEEVLQM
GNQVAQHIVKVFSMCCLKHCVALWQLLVSLKSENMLRLKRDPFVGVPEKYKLPLGEEEHR
LLTAFFSKNSADTFLLEMHEFLVLVLKKSNDPDAYRPDWGLKESLVSYMEQKDMDIPPDV
EEHFPEEIFLSHYVEAWKFIIAFKQERGQRQ
Download sequence
Identical sequences M4ACP8
ENSXMAP00000012242 ENSXMAP00000012242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]