SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012656 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012656
Domain Number 1 Region: 224-316
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000759
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 2 Region: 108-173
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000531
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012656   Gene: ENSXMAG00000012623   Transcript: ENSXMAT00000012672
Sequence length 620
Comment pep:novel scaffold:Xipmac4.4.2:JH556690.1:2976580:2990460:1 gene:ENSXMAG00000012623 transcript:ENSXMAT00000012672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFCGTQNSGRRSKWDQPDAGTGGSGGMREAEAAPCGALDAAAAVAAKINAMLVAKGKLK
PSQISSPLSSDKIVGAGKPPAPTKAKDDLVVAEVEINDVPLSCRNLLTRGQTQEEISKVS
GAAVSTRGRYMTADEKNKALLGDRPLYLHVQGQTRELVDRAVNRIKEIITNGVVKAATAS
SAAPSFSPSGASVTIYQQHNPPAPSLPPATNHKPHFQSGMHYVQDKIFVGLEHAVPGFVV
KERVEGPACSYLQHIQAETGAKVFLRGKGSGCLEPASGREAFEPMYIYISHPKPEGLAAA
KTLCENLLLTVHAEYSRYLSQMNTIMPTQQGFSQPPVVNGIPPQPPYYPPAGFQPSYSVP
GPPPQPQPVPPTYTVPPPAPPVMQSSSHGVPSQYPIRPSSAPLPAPIPAPIAVSIPAPTL
APVPAPILTLPPLHFAPPAAPPKLPLQAAPINPPQKRRFTEEVPDERDSGLLGYQHGPIH
MTNLGAGFSVGSAETSGPTQQSSSGPASERDSRHMMPPPTSLRVNGVRHQMEDRRLHQAF
VEPPVKRLRSGLVAYSGDSSDEEEDHPSSKASWLGNHGAGNHPPTSTASSWAQGYRGPPP
LPTRAKTQPQQQSIPFWMAP
Download sequence
Identical sequences M4ADW2
ENSXMAP00000012656 ENSXMAP00000012656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]