SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014131 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014131
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-25
Family DBL homology domain (DH-domain) 0.00093
Further Details:      
 
Domain Number 2 Region: 93-238
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000369
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014131   Gene: ENSXMAG00000014108   Transcript: ENSXMAT00000014150
Sequence length 303
Comment pep:novel scaffold:Xipmac4.4.2:JH558550.1:3831:13989:-1 gene:ENSXMAG00000014108 transcript:ENSXMAT00000014150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKETIVRCEKQKARFHAFLKINQAKPECGRQTLAELLIRPVQRLPSVALLLSDIKKHTS
DDNPDKITLERAIESLKEVMTHINEDKRKTEGQKQIFDVVYEVDGCPANLLSSHRSLVHR
VETIALGDEPCDRGEHVTLFLFNDCLEIARKRHKVINTFKSPVGQSRPPPPLKHIALMPL
SQIRRVLDLHDTEECVNAFALVVRPPTEQENLLFSFQLAGEETVKRDWLRTLCRHVANTI
CRADAEDLIQCTEPDSLQVTTKDMDSTLSKASRAIKKTSKKVTRAFSFTKTPKRVLQRAF
LAN
Download sequence
Identical sequences M4AI37
ENSXMAP00000014131 ENSXMAP00000014131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]