SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014822 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014822
Domain Number 1 Region: 541-595
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000732
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014822   Gene: ENSXMAG00000014786   Transcript: ENSXMAT00000014842
Sequence length 742
Comment pep:novel scaffold:Xipmac4.4.2:JH556879.1:691103:704793:-1 gene:ENSXMAG00000014786 transcript:ENSXMAT00000014842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGGEEEFMSDDGGGTPVQDEHPQSDGEEMRSDGRQSEDDGSNDEDATIAMETGGAASSS
DAEDRCRADSDSEDEAPGGRRDKSDSEAEPRRPGDSDDEDSPAKRRASASDEEEEESLRK
RRQSGSEDEASSPVKRGASDNEGEEEEDVSSPAKRRGSSSEPEDAPRGDGARSNSDNEED
KPVPASSPRQHSDSDSDAEPPARRQVAPIDSDEEDEGKREEEEETGGGKWKGVMQSDSED
EEDEGQRKKAATGSDEEQREEGEKKQQRDDSEEEDDKPVKRKKVILSDSEDEDEEKEDKP
AAKRSRAVSDDDENSGSGDGSVGPDRSLAAKLRELGSDSGSDEEDRSKPAVVKKDEKALF
GSDSDSGEDDEEEKMIADIFGESGDEEEEEFTGFNQEELEADSKQPKQQQQAADESDSDE
GVDRSGQDTSFMSDFDIMLAKRKAMNSRKRRHRDGGTFISDADDVVSAMITKMNEAAEED
RTLNSQKKPALKKLTLLPQVVMHLKKQDLKETFIDSGVMSAIKEWISPLPDKSLPALRIR
EELLRILQELPNVSQETLKHSGIGRAVMFLYKHPKESRANKDLALKLINEWSRPIFGLTS
NYKGMTREERQQRDLDQQTPQRRRLSEPQKVERAQEPDVFSPPTSSGGQTPRRDLEKQLT
GEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEGDSSRSGYKKAISLLEKHKRRFAE
QRKLRRPQGAVKISIEGNRMPL
Download sequence
Identical sequences M4AK28
ENSXMAP00000014822 ENSXMAP00000014822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]