SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015153 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015153
Domain Number 1 Region: 900-1029,1224-1413
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.26e-51
Family p120GAP domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 593-696
Classification Level Classification E-value
Superfamily E set domains 0.000000000000056
Family Other IPT/TIG domains 0.075
Further Details:      
 
Domain Number 3 Region: 504-589
Classification Level Classification E-value
Superfamily E set domains 0.000000000000165
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 4 Region: 408-506
Classification Level Classification E-value
Superfamily E set domains 0.000000000000178
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 5 Region: 62-112
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000262
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 17-65
Classification Level Classification E-value
Superfamily Sema domain 0.00000049
Family Sema domain 0.015
Further Details:      
 
Domain Number 7 Region: 694-786
Classification Level Classification E-value
Superfamily E set domains 0.00000358
Family E-set domains of sugar-utilizing enzymes 0.061
Further Details:      
 
Domain Number 8 Region: 360-396
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000235
Family Plexin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000015153
Domain Number - Region: 208-245
Classification Level Classification E-value
Superfamily Plexin repeat 0.0955
Family Plexin repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015153   Gene: ENSXMAG00000014953   Transcript: ENSXMAT00000015173
Sequence length 1443
Comment pep:novel scaffold:Xipmac4.4.2:JH558022.1:8467:31025:1 gene:ENSXMAG00000014953 transcript:ENSXMAT00000015173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSVFQIRVDGVLPPAQNALLYETVAVAEGQPILRDMVFSPDHRSIYLLSHRQVTRLPVE
SCQQYSSCSDCLGSGDPHCGWCVLFNKCSRKESCDRWEEPQHFNTRLDQCVFISVSPSNM
SVTSPPTQLTIRVQNVPELSGGVTCVFEDLTETPGQVQAEGQVVCMSPSLEELPAQAPPY
GEKRAVQLSLRSTETGLRFISTNLVYYNCSVLGSCTSCVSSSFPCLWCKFRHICTNNLKD
CSFQEGRVSSMEGCPQILPTADILVPAGMVRPITLRARNLPQPQSGQKNYECVFSIQGKV
QRIPAVRFNSSCIQCQNTSYWYEGDEAGDLQVDFSIVWDENFLIDKPTFMKALLYKCEAQ
RSSCGQCLKAPPVFECGWCVESRKCLLRQHCPSPEQNWMHHGGHNLRCSHPRISKIDPLT
GPREGGTRVAIEGENLGLQVKEITHIQVAGVRCNPVPSLYVSAERIVCDMAEALLPHSPG
GPVELCIGVCSAEYRTLSTQTYSFVSPSFTRIRPLMGPVSGGTRLTVVGRHLDSGSGVSV
FVHKEECLFVKRTNREVVCITPASPSGAGPAPVRLMIDRAEVTNAEVSYGYSEDPTVSGI
EPNWTIFNGSTLITVTGTNLQTIQEPKVRAKYGGVETSNYCTVVNDSTMTCLAPGLVYNK
PDQPEGALRPDEFGFILDQVSSLLVLNSTPFTHYPNPTFDPLGPAGILEVKPGSPIILKG
KNLIPPAPGNARLNYTVLIGESPCLLTVSENQLLCDSPDLTGEQRVAIQVGGLEYFPGIL
HIYSDNTLTLPAIIGIGAGGGVLLIAIIAVLIAYKRKTRDADRTLKRLQLQMDNLESRVA
LECKEAFAELQTDIQELTNDMDGVKIPFLEYRTYTMRVMFPGIEEHPVLKELDSPANVEK
ALRLFSQLLNNKMFLLSFIHTLEAQRSFSMRDRGNVASLLMAALQGRMEYATVVLKQLLA
DLIEKNLENRNHPKLLLRRTESVAEKMLTNWFTFLLHRFLKECAGEPLFMLYCAIKQQME
KGPIDAITGEARYSLSEDKLIRQQIDYKQLTLMCIPPEGEAGTEVPVKVLNCDTVTQVKD
KLLDAVYKGIPFSQRPQADDMDLEWRQGRLTRIILQDEDVTTKIESDWKRLNTLAHYQVT
DGSLVALVQKQVSAYNIANSFTFTRSLSRYESLLRTSSSPDSLRSRAPMITPDQETGTKL
WHLVKNHEHSDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTAHRGSALPL
AIKYMFDFLDEQADKRSITDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACL
SVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDISKMPSISDQDMDA
YLVEQSRLHGNEFNTLSALNELYFYINKYKEEILTALDRDGYCRKHKLRHKLDQAINLMS
GSS
Download sequence
Identical sequences M4AL09
ENSXMAP00000015153 ENSXMAP00000015153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]