SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015311 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015311
Domain Number 1 Region: 528-752
Classification Level Classification E-value
Superfamily GFP-like 7.64e-79
Family Domain G2 of nidogen-1 0.000000939
Further Details:      
 
Domain Number 2 Region: 1120-1374
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-39
Family YWTD domain 0.000000232
Further Details:      
 
Domain Number 3 Region: 1024-1093
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.27e-18
Family Thyroglobulin type-1 domain 0.00098
Further Details:      
 
Domain Number 4 Region: 487-525,806-846,880-935
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000487
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 5 Region: 941-996
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000288
Family Thyroglobulin type-1 domain 0.0024
Further Details:      
 
Domain Number 6 Region: 762-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000739
Family EGF-like domain of nidogen-1 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015311   Gene: ENSXMAG00000015224   Transcript: ENSXMAT00000015332
Sequence length 1385
Comment pep:novel scaffold:Xipmac4.4.2:JH557220.1:144154:188968:1 gene:ENSXMAG00000015224 transcript:ENSXMAT00000015332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTAALLCCWSCTVCVVTAIRRTDLFPFGDLNGDLILPEGDDETSRALTLPRPFYFFDSP
FSQLYVATNGIVSAQDLPMEKQYVDDGLPTDFPVVAPFLADIDTSGGRGNIYYRLTETPS
VLNRFAQEVHRGFPDAKFTPTHAVVATWENVAAYEEQARATGATNKVNTFQTVIGYDETD
SYVLFLYPEDGLNFFGTRPKESYNVEIEFPARVGFSRGEVSFFIISKTDGPFYSVAQDEN
SVKRLSQVGNTGVPGVWLFHTGKRFSFQEIIPASIGGPLSSHRSEDFTCFLSKDTTTPEY
EFDDYNFEPESQEEVDAAGSPDSPNTRSEDSDRQLSYNREDVPLTLEPVERQYAPPGFPL
TVPEGRTQRVEEQQPQRFIWLPLEVVDVYPPLRNPPPSGGHVVSVDEEDVDFDTGEQTQS
SFQQDRCAYPVPKKKERKFYPAFGNFQHSYQETCLLHFLNAGFYIFLISNIRGNEQSVIQ
YTTENKETCARFQQQCSQNAFCSDYATGFCCHCRPGFYGNGRHCLPDGAPQRVSGKVSGT
VTVGSTPVELNNIDLHAYIVVGDGRAYTAISEVPEPVGWAMMSVSPVGELFGWLFALELP
NSQAGFKITGAEFSRHAEVVFSPGNQRLSITQTGRGLDEHNHLSVDTVINGNVPFVPPGA
EVTMKPFKETYQYYPSVATSSSVREFSVGLPEKASESYTFHLKQNITYRDCRHGNQAATP
ETLQINMERVFVMYVKEERILRYAITNKISPVVTDSSEVELLNPCYAGNHDCDTTAQCIP
LEGQAFRCQCATGYRGDGQNCYDIDECAEGLSSCGDYSQCLNLPGTHRCQCQSGFELGYE
SRTCVVIFAGKQVKIDPSWIYVTKGPAEVVFHSINAQLCYCITIFWGKQNLCFSDIDECM
SSPCHISAICVNAQASFQCQCLPGFYGDGFNCSPQDKPDQPERPKTPCEHHKERVQASGS
REYPVAGAYVPQCDADGQYIPLQNFATSLCWCSTKRLCETRMTSLRFGTASMSCSEPPPP
TNRAESVCERWRASLIEHYGGNPDPQQYLPQCEPDGEFSPVQCYGESTYCWCVDQEGREV
DGTRSHDAVKPACLPSVAPPIVRPITRPDVTPPAKTAVTLLYAQGQKIGALPLNGSRLDA
ERSKTLLTLHGSIVVGIAYDCKENKVYWTDLSARTINRASMASGAEPETLINTNLVSPEG
LALDAKRRLMFWVDSNTDVIESASLDGSRRRTLFDSDLVNPRAIVVVSSTGSLYWTDWNR
EAPKIETSTVDGQGRRVVVSDGVGLPNALTYDLSSGQICWGDAGTKRLECISPNGSGRRV
INSDLNYPFSMVYHSNHFYFSDWRRDGVIAVDKVSSKFTDEYLPEQRSHLYGITIATTHC
LPGEM
Download sequence
Identical sequences M4ALG7
ENSXMAP00000015311 ENSXMAP00000015311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]