SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015455 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015455
Domain Number 1 Region: 240-481
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-52
Family Voltage-gated potassium channels 0.00087
Further Details:      
 
Domain Number 2 Region: 80-193
Classification Level Classification E-value
Superfamily POZ domain 1.88e-26
Family Tetramerization domain of potassium channels 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015455   Gene: ENSXMAG00000015430   Transcript: ENSXMAT00000015477
Sequence length 515
Comment pep:novel scaffold:Xipmac4.4.2:JH558645.1:10659:13118:-1 gene:ENSXMAG00000015430 transcript:ENSXMAT00000015477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWTRRQSLFPNYKVTDSDAARRPSEVVYPLAKESCVKTWNSMQELSRDIYDIYAEYEEEE
EEGGPFSFSRQISPSKKNYVININVGGKPYQIAYKMAAKYPKTRIGRLATYTDHNMKLDL
CDDYIVTSNEYFFDRDPEVFHSIFNFYRTGVLWIKDELCPRNFLEEINYWGVRIKNTNRC
CRISFEERQDELNDQLKIQRELEAEVEIEENEELFHDMFMGQTRRAIWNLMEKPFSSVQA
KMMAVASSLFVLISLVAMTLNTVEEMQYKTHAGHLSGKTYCEYVESICIAFFTMEYVLRL
ISTPDLRSFSRSVLNTVDLIAILPQYLQGILEYFDSEENYMKHEADIKAVGQVGKLGQVL
RIMRLMRIFRILKLARHSTGLRAFGFTLRQCYQQVGCLFLFIAMGIFSFSAMVFTVEHDM
PQTNFTSIPHAWWWAAVSISTVGYGDVYPETVLGRVFAFICIAFGIILNGLPISILFNKF
SDYYSKLKSNQYTACLKKRGKVRFAKRTINSLSSC
Download sequence
Identical sequences M4ALW1
ENSXMAP00000015455 ENSXMAP00000015455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]