SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016084 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016084
Domain Number 1 Region: 146-426
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-94
Family Protein kinases, catalytic subunit 0.000000000419
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-20
Family Pleckstrin-homology domain (PH domain) 0.0000711
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000016084
Domain Number - Region: 99-143
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0628
Family TrmB middle domain-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016084   Gene: ENSXMAG00000016020   Transcript: ENSXMAT00000016108
Sequence length 430
Comment pep:novel scaffold:Xipmac4.4.2:JH558479.1:9555:24439:1 gene:ENSXMAG00000016020 transcript:ENSXMAT00000016108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKADGSFIGYKDKPQDSDLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDESIRDEWAEAIQMVAESLAKQEEEGIL
CSPTSQIENVNEEEMDTSISHYKRKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMKI
LKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLS
RERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGIT
DTATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELI
LMEEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFGTIDWQDVYDKKV
STAFIRHTSS
Download sequence
Identical sequences M4ANN9
ENSXMAP00000016084 ENSXMAP00000016084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]