SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016551 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016551
Domain Number 1 Region: 180-410
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-55
Family Voltage-gated potassium channels 0.00079
Further Details:      
 
Domain Number 2 Region: 40-144
Classification Level Classification E-value
Superfamily POZ domain 1.1e-31
Family Tetramerization domain of potassium channels 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016551   Gene: ENSXMAG00000016505   Transcript: ENSXMAT00000016575
Sequence length 622
Comment pep:novel scaffold:Xipmac4.4.2:JH556669.1:2622231:2686946:-1 gene:ENSXMAG00000016505 transcript:ENSXMAT00000016575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVAAWLPFARAAAIGWMPVASTPMPIPPQDKRKAQDGLIILNVSGTKFQTWRTTLER
YPDTLLGSTERDFFFHEETSEYFFDRDPDIFRHILNFYRTGKLHYPRQECISAYDEELAF
FGIIPEIIGDCCYEEYKDRRRENAERLQDDEEMDMNNDVTPVNLTFREYLWRAFENPHTS
TLALVFYYVTGFFIAISVMANVVETVPCGTLPNRSKEMSCGDRYALAFFCLDTACVMIFT
VEYLLRLIAAPSRCKFMKSVMSVIDVVAIMPYYIGLVMTDNDQVSGAFVTLRVFRVFRIF
KFSRHSAGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSTATKFTSIPAAF
WYTIVTMTTLGYGDMVPKTIVGKVFGSICSLSGVLVIALPVPVIVSNFSRIYHQSQRAEK
RRAQRKTRLARIRAAKIRGTNAYMRYKQNGLLIDALEEASKEAGQALVGKAASPPFESQH
HHLLHCLEKTTNHEFVDEQTFQANCMEISVVNKSGSRTSSLSSSPHGLSSCCSRRHRKKS
SFSLPSTNNQELSTIQIRERPVSNSRSSLNAKLDETMPLKCDEAYISPSMVRLSAPVATS
SDDASTATTTYSQSNIVRVSAL
Download sequence
Identical sequences M4AQ06
ENSXMAP00000016551 ENSXMAP00000016551 XP_005796338.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]