SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016717 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016717
Domain Number 1 Region: 14-230
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-53
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016717   Gene: ENSXMAG00000016687   Transcript: ENSXMAT00000016741
Sequence length 280
Comment pep:novel scaffold:Xipmac4.4.2:JH556674.1:828118:830458:1 gene:ENSXMAG00000016687 transcript:ENSXMAT00000016741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLTSCTLWQDLEEVKASGLPNILTPKEIDLQESMFELIVSEVSYLKSLGVLVNHFYASKV
LKKTMSTMEHHTLFCNIRHVMEANTKFLLDLEARLGESLTIFQVGDIVLQHCGTFKRHYV
PYVINMTYQESLVNQLMQQNKNFVYVLKKLERDPVCQKQGLKSFLILPFQRITRIKLLLE
SILKLTEPDSEAASNLSKAIKGIHEIVLECDQKVEKMKRLEELIRLETLMDFDDIKLVPL
VKSTRFLVLHGPLDTVVTYGSKLSTVRIYLHLFNDLLIIS
Download sequence
Identical sequences M4AQH2
ENSXMAP00000016717 ENSXMAP00000016717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]