SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016758 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016758
Domain Number 1 Region: 61-156
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000000602
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.01
Further Details:      
 
Domain Number 2 Region: 756-781
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000209
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016758   Gene: ENSXMAG00000016711   Transcript: ENSXMAT00000016782
Sequence length 805
Comment pep:novel scaffold:Xipmac4.4.2:JH556777.1:96722:104743:1 gene:ENSXMAG00000016711 transcript:ENSXMAT00000016782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGPVDPREILKGVEALLGKDGELRSLEGVPKVFSLMKASTKMVSRCMYLNVLLQTKSH
DILNRFIRVGGYRLLNSWLTYSKTTNNSPLLQLILLTLQKLPLKVDHLKQNNTAKLVKQL
SKSAETEELRKLAAVLVDGWMATIRSQSVSSSGSSPADKKKKKEESKMPVRDVKEKSGDE
GRKKEKSKAHAPSHTKIRSIGLEMEASNPTPPKKMSSAPQLGEKYIIKAPLLKRPSSGPS
DAPPLEKKYKPLNQPPNATKEIKMKIIPALPMEATDFVDALNSAPVPEIKIKKKKPPGAS
TPANTKAVSPTSTKTNPFDSKPAGYSPSSARPASPETSASSIAADENQEPEQPLTPIPAE
DPDTADNTEKPNALAEPRADEESLTKKGKKKKTVHWAEEEQLKHYFYFDLDETERVNVNK
IKDFGEAAKRELMMDRQTFEMARRLSHDTMEERVPWTQPRPLTLAGSLVTPGANSTEKHT
QREREMGILQEIFLSKESVPDSPHEPDPEPYEPMPPCLIPLDEDSSMMDEDYGEPADAAS
QQAQSESSKLPPVLANLMVNLSSSARSPQASSTTSNPTAPVVNVQELLSSIMGASGGQST
EELIKQPDFSDKIKQLLGSLQQSQIQTQGGPPPVNLGLLGHGPGMNNMTNMHMQGPMNGG
YPPNSSPGGPRFNHPPPPHNHGPPFNNPGGPRMMGPRPGQGRGENGNYWGEDSMRGGPHR
GGHFHRGGRGRGGDLGFRGRGRGGPRGGHNNMNDMSKRPVCRHFMMKGSCRYESNCAFYH
PGVNGPPLPPNYPPNQHNQHPQHGH
Download sequence
Identical sequences M4AQL3
ENSXMAP00000016758 XP_005804531.1.87360 XP_005804532.1.87360 ENSXMAP00000016758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]