SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017198 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017198
Domain Number 1 Region: 232-424
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-31
Family DBL homology domain (DH-domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017198   Gene: ENSXMAG00000017168   Transcript: ENSXMAT00000017222
Sequence length 840
Comment pep:novel scaffold:Xipmac4.4.2:JH557019.1:194209:213588:1 gene:ENSXMAG00000017168 transcript:ENSXMAT00000017222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENDGTEAEEKVEDLPEDTTEGVEERPREISKVQGLLVELREGLRAAVAELADLRQRDHV
LEEKLQAHQTEVDDKIMGLKNSLNTFKEELNVALFHIRDMSNRQREAQRRMELLQIESNK
DIIPLPHRSSSRKSSRSDVLALSGEEHICTPSQSELSVYQSFSPTLPQGESPQRSNTSTQ
SESVCLGKSSSMLAATCDQEAQQQQQKSPSWGDKTNNRDQMEISNNQTENNKRQRAALEL
LESERVYVSHLSLLLKANISFNGAEAPTMKDKRPFPSSLRFLIQQHLELLHTLQERVLRC
QWQGIMGDVFMRLTSKESDFLDFYVSYLKELPDCLSVVTMLASSSMKSAAFVDRDVLGDE
SRPSLYTLLLQPVQRIPEYLLLLQGLLRQTDADHPDYYLLLVCIQQFRSFTAQHHHLLQH
NQELLLLNRKEVQSLLCSTSRSNMKQLLKTVEGGIQTNISSPYPGSNAILEHANMVKRRK
QCLLEQIQSHRFQDWDHSQDPQGRCYNAEWPSQVPFFSHNLDSRNPKQTGLGSIPETEMS
ERSCQHNQVPTRPAEFRQVQPGSALADALGEFLLPPDPPGMESLYDEDGVSLHDTSLFDH
CSSASSDSSIDIAFVKCPKVPQGSHHAVAINVPTNRDVFGNGGSPGNGYSKLPNRGCVSP
DEAVTRRNLHRPLQASQRKSKSLNGLQMENTVSGLDVGPLSDHLLRVGLGSHAKLERQGS
KGSKCSTPSHKVHSPLGNTDKQSPDLHGLLNIDSGIQSWADESKWRSTTEENNHTPFSER
SRKDKGGFRSSFKKLFKKKAADEKKEKGGEKTPENQNGEHETSMKTPKLVHLEINRGTAV
Download sequence
Identical sequences M4ARV3
ENSXMAP00000017198 ENSXMAP00000017198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]