SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017239 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017239
Domain Number 1 Region: 866-945
Classification Level Classification E-value
Superfamily DEATH domain 6.06e-24
Family DEATH domain, DD 0.0000384
Further Details:      
 
Domain Number 2 Region: 171-263
Classification Level Classification E-value
Superfamily Immunoglobulin 5.95e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 262-313
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000785
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 4 Region: 318-365
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000314
Family TSP-1 type 1 repeat 0.00066
Further Details:      
 
Domain Number 5 Region: 65-167
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000169
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017239   Gene: ENSXMAG00000017169   Transcript: ENSXMAT00000017263
Sequence length 955
Comment pep:novel scaffold:Xipmac4.4.2:JH556662.1:5588799:5790274:-1 gene:ENSXMAG00000017169 transcript:ENSXMAT00000017263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKSGLRSGVAPGGSCLVRMFATPEILVLLVLTHAGVAQVRDEDDFLSLSELPETFPSDP
PEPLPHFLFEPEEGYIVKNKPVNLYCKATPATQIYFKCNSEWVHQKDHTVEERVDENSGL
VVREASIEITRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAHVRIAYLKKSFEQEPLGKE
VSLEQEVLLQCRPPEGIPAAEVEWLKNEEIIDPAEDRNFYITIDHNLIIKQARLSDTANY
TCVAKNIVAKRRSTTATVIVYVNGGWSTWTEWSPCNSRCGRGFQKRTRSCTNPAPLNGGL
PCDGQAIQKLPCTTLCTVDGVWTDWSKWSACGTECTQYRRRECNNPAPKNGGKDCEGLVL
QSQNCTDGLCMQSSLFQKSTEPKEHSALGIPSAPSTDDVALYVGIVIAVIMCLFISAIVA
LFVYRKTHRDFDSDIIDTSALNGGFQSVNIKTARSADLLTAPPDLTNAAAMYRGPVYALH
DVSDKIPMTNSPLLDPLPNLKIKVYNSSGLVTPPDDLGGDFTSKLSPKVTHSLLDNSDSL
NIRSQSLARTRDPSCTAHGSFSSQGGHLIVPNSGVSLLVPAGAVPPGRVYEMHVTVHRKD
SVRPLVEDIQTVLSPVVSCGPPGVLLTRPVILTIHHCADNVHEDWLIQLKNQLPMGEWED
VVVVGEENFTTPCYVQMDLEACHILTETLGTYCLVGQSIGKAAAKRLKLAVFGPVSCTTL
DYHIRIYCLDDTQDALKEVLQMETQMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHTHWKS
KLIAKYQEIPFYQVWSGCQRTLHSTFTLERLSSATTEISCKLCVRQVEGEGQIFQISSTL
EEEVQCIDTSLMDPASNITTLMGPNAFRIPLSIRHKLCGSLDAPQTRGNDWRMLAHKLNL
DRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRHDSSLASMTSEH
Download sequence
Identical sequences M4ARZ4
ENSXMAP00000017239 XP_005795127.2.87360 ENSXMAP00000017239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]