SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017634 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017634
Domain Number 1 Region: 131-242
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.83e-36
Family Elongation factor TFIIS domain 2 0.0039
Further Details:      
 
Domain Number 2 Region: 6-93
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 8.89e-26
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000789
Further Details:      
 
Domain Number 3 Region: 258-309
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.02e-16
Family Transcriptional factor domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017634   Gene: ENSXMAG00000017586   Transcript: ENSXMAT00000017659
Sequence length 311
Comment pep:novel scaffold:Xipmac4.4.2:JH557747.1:43136:51114:-1 gene:ENSXMAG00000017586 transcript:ENSXMAT00000017659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKEEEEIIRIAKKMDKMAQKKNGAGALDLLKELRSVPMTLELLQSTRIGMSVNAIRKQ
STDEEVTSLAKSLIKSWKKLLDEPGGGEKAPDEKRKEQTTPVVSPSQGSPEPKEESSSSS
NSSSKSETSEVASNTFTTSFPRAPTTSDSIRLKCREMLASALQTGEDHIAIGADCEELGA
QIEEYIFQEFKNTDMKYKNRVRSRISNLKDMKNPNLRRTVLCGSVTPERMAKMTAEEMAS
DELKEMRKNLTKEAVRDHQMATTGGTQTDLFTCGKCKGKNCTYTQVQTRSADEPMTTFVF
CQQCGNRWKFC
Download sequence
Identical sequences M4AT39
ENSXMAP00000017634 XP_005815099.1.87360 ENSXMAP00000017634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]