SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000019284 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000019284
Domain Number 1 Region: 610-900
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-82
Family Protein kinases, catalytic subunit 0.00000000103
Further Details:      
 
Domain Number 2 Region: 29-200
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.78e-71
Family Ephrin receptor ligand binding domain 0.00000123
Further Details:      
 
Domain Number 3 Region: 324-523
Classification Level Classification E-value
Superfamily Fibronectin type III 1.61e-36
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 4 Region: 895-967
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.93e-20
Family SAM (sterile alpha motif) domain 0.00047
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000019284
Domain Number - Region: 243-322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000273
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000019284   Gene: ENSXMAG00000019223   Transcript: ENSXMAT00000019312
Sequence length 973
Comment pep:novel scaffold:Xipmac4.4.2:JH556675.1:2110341:2195361:-1 gene:ENSXMAG00000019223 transcript:ENSXMAT00000019312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSLGLYQYITQWKLVVGLQLLKKPCCKVTLLDSMSALADLGWEAYPNEGWEEISVMDER
NTPMRTYQVCSVMEANQNNWLRTRHISREGAQRVYIEIKFTLRDCNSLPGVSGTCKETFN
MYYYESNNANLWFIKESQYVKIDTIAADESFTQVDVGDRVLKLNTEVRDISNLSKKGFYL
AFQDLGACIALVSVRVFYKKCPLTVRNLAQFPDTITGGETALVEVHGVCVNASEEFEPPK
MYCSADGGWLVPIGRCVCKPGFEENKDICQPCRPGTYKASATDAYCTKCPPHSSSPHEQA
MECICEKGFYRAETDPRSMACTRPPSAPENPISSVNETCVTLEWSPPRDTGGRGDITYSL
HCRKCSGEGKKCAPCGSSVHFVPRQFGLSSASVLITDLQPDSNYTFTIESQNGVSDLSPT
LRGTVVINVTTSQTVSVVLKERRSKDSVTLAWQGPERPNGAIVEYEVIYYEKNQREQNYT
VLKTRSNMMTVDGLKPGTTYVFRVRARTDGGYGTYGGEIELETSHEDVLAIGDPNQSTIL
VVSIAGGIVLLIFLVTCFVVSGRHCGYIKAKQDPDEEKMQFQHGRVKLPGSRTYIHPHTY
EDPNQAVRDFAKEIDASNIRIERVIGAGEFGEVCSGRLRVQGKREIYVAIKSLKAGYSDK
QRRDFLSEASIMGQFDHPNIIRLEGVVTKCKPVMIITEFMENGSLDTFLKKHDGQFTVIQ
LVGMLRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEAAYTTR
GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVISYGERPYWEMSNQDVIKAIDEGYR
LPAPMDCPVVLHQLMLDCWEKGRSDRPKFGQIVTILDKLIRNPASLRELANSSAWEDPPT
PEFSVSTVDDWLDTIKMGQYKENFSSAGYVSLDSILYISVSELAKMGVTLAGHQKKILSS
VQSLQTQGTHVQV
Download sequence
Identical sequences M4AXT9
ENSXMAP00000019284 ENSXMAP00000019284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]