SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000019505 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000019505
Domain Number 1 Region: 183-212,243-441
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.63e-56
Family Voltage-gated potassium channels 0.00055
Further Details:      
 
Domain Number 2 Region: 59-155
Classification Level Classification E-value
Superfamily POZ domain 5.76e-25
Family Tetramerization domain of potassium channels 0.00000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000019505   Gene: ENSXMAG00000019458   Transcript: ENSXMAT00000019533
Sequence length 484
Comment pep:novel scaffold:Xipmac4.4.2:JH556892.1:570303:572027:-1 gene:ENSXMAG00000019458 transcript:ENSXMAT00000019533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPSRKGRSSCASIISNWKLLLNSEGMKESETIFSRLTKECCEDLFADKRGLDDGDQKV
IINIAGLRFETQLKTLDQFPETLLGDPFKRTEYFDPMRNEYFFDRNRPSFDGILYYYQSG
GKIRRPANVPLDVFADEIVFYELGHEAMEQFREDEGFIKDVDIPLPKNEIHRQFWLLFEY
PESSNAARGVALVSVLVIVISIIIFCMETLPEFRDDTELFFPRVVQHVNQSKVSHSGSLA
GAKLKTLSDPFFFVETVCIAWFAFELIVRFVVCPSKSEFFHNLMNMIDIISIIPYFVTLM
TELATTPQESSGQNMSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIF
FLFIGVILFSSAIYFAEVDDPDTQFVSIPDGFWWAVVTMTTVGYGDMCPITLGGKVVGTL
CAIAGVLTIALPVPVIVSNFNYFYHRETEAEDKVPMTEALEQAIKAEESTKQGSNPSVNK
VNGI
Download sequence
Identical sequences M4AYG0
ENSXMAP00000019505 ENSXMAP00000019505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]