SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000019511 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000019511
Domain Number 1 Region: 203-447
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-60
Family Voltage-gated potassium channels 0.0004
Further Details:      
 
Domain Number 2 Region: 74-171
Classification Level Classification E-value
Superfamily POZ domain 7.06e-27
Family Tetramerization domain of potassium channels 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000019511   Gene: ENSXMAG00000019464   Transcript: ENSXMAT00000019539
Sequence length 534
Comment pep:novel scaffold:Xipmac4.4.2:JH556892.1:614793:616397:-1 gene:ENSXMAG00000019464 transcript:ENSXMAT00000019539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLQPRMDDHLSLLQSPPPSATKTRGDNLVNHGYTETETDVMTVVACDNMLEESAALPGH
HSLDRYEPDHECCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFD
RNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYELGEEAMEKFREDEGFIKEEERP
LPDNEFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDENRDPITIA
PLINGTLPYFISPFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSKNIMNIIDIVAII
PYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRE
LGLLIFFLFIGVILFSSAVYFAEADDPESGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGG
KIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDGEEQAQYLHVGSCQPLADTEELRKT
RSSSSLSKSEYMVIEEHGINSAFKQQPNFPTTTTTAQNNSQNCVNINKKIFTDV
Download sequence
Identical sequences M4AYG6
ENSXMAP00000019511 ENSXMAP00000019511 XP_005808703.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]