SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000019782 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000019782
Domain Number 1 Region: 128-227
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 7.32e-24
Family Elongation factor TFIIS domain 2 0.0025
Further Details:      
 
Domain Number 2 Region: 2-91
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 7.59e-16
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.003
Further Details:      
 
Domain Number 3 Region: 250-307
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000374
Family Transcriptional factor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000019782   Gene: ENSXMAG00000019735   Transcript: ENSXMAT00000019810
Sequence length 313
Comment pep:novel scaffold:Xipmac4.4.2:JH557092.1:48790:49731:-1 gene:ENSXMAG00000019735 transcript:ENSXMAT00000019810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMETKEIVHCALQIEKLAAEQSFGSISTLLGDLDRCDISPEQLEMTDIVKVLYKLLKTCR
ESSVRKTVKSLLSRWKRQYGSEWQGNSGNSHAVPSGQTEDGGVSKDSAQMGGNKEERASG
QECETPTGETTSPSSDSVRTKCVQLLLSALHPEPPDGDKAAELAESIERHIHRLHKTKHL
KYKACVRSKVANLRNPKNSHLRQGLLSGSLVPESFARMSVEEMANAELRQLREEYSSRAV
SERQLPQGLEGTPTQKVRCKRCGGSDCRMTQVSRGALFLPAWVRRGGPDEDAMTFVTCSG
CGQQWYHNAWVCL
Download sequence
Identical sequences M4AZ87
ENSXMAP00000019782 ENSXMAP00000019782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]